DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXA3

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_004488.2 Gene:FOXA3 / 3171 HGNCID:5023 Length:350 Species:Homo sapiens


Alignment Length:277 Identity:96/277 - (34%)
Similarity:125/277 - (45%) Gaps:66/277 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PQYGGTGGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQP-EEPKPQHSYIG 136
            |.:.|.|.||.|:.    |.||..|.|.:....          .|:..|  :| ...||.:|||.
Human    76 PTFPGLGVSGGSSS----SGYGAPGPGLVHGKE----------MPKGYR--RPLAHAKPPYSYIS 124

  Fly   137 LIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGH 199
            ||.|||..:....|.||:|||:|:|.:||:|.....|:|||||:||.||||:|..||.:  |||.
Human   125 LITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGS 189

  Fly   200 YWAIHPANMEDFRKGDFRRR----KAQRKVRK-HMGLSV-------DDASTDSP-----SPPPLD 247
            |||:||::...|..|.:.||    |.:.||:| ..|.:.       ..|||.:|     |||   
Human   190 YWALHPSSGNMFENGCYLRRQKRFKLEEKVKKGGSGAATTTRNGTGSAASTTTPAATVTSPP--- 251

  Fly   248 LTTPPPPS----SQSALQLSAL--GYPYHQHYIGQFFNRSSAPGMTHYSPPD------PALLMQR 300
              .||||:    :|....:.||  |.|           .||.|..|....|.      |......
Human   252 --QPPPPAPEPEAQGGEDVGALDCGSP-----------ASSTPYFTGLELPGELKLDAPYNFNHP 303

  Fly   301 QEANNL--DQTIQPTQL 315
            ...|||  :||..|.:|
Human   304 FSINNLMSEQTPAPPKL 320

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
FOXA3NP_004488.2 FH 117..205 CDD:214627 45/87 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 217..276 19/63 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.