DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXA2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_068556.2 Gene:FOXA2 / 3170 HGNCID:5022 Length:463 Species:Homo sapiens


Alignment Length:328 Identity:98/328 - (29%)
Similarity:137/328 - (41%) Gaps:101/328 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GTGGSGASA------PWL--HLSPYGHHGSGSLPSVNRMAALSTIS-LFPQT--QRIFQPE---- 126
            |.|||..:|      |.|  .|||.|...:|::..:...|.::::| ::.|.  .|...|:    
Human    95 GMGGSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRR 159

  Fly   127 ---EPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFI 188
               ..||.:|||.||.|||..|.:..|.||:|||:|:|.:|::|.....|:|||||:||.||||:
Human   160 SYTHAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFL 224

  Fly   189 KSGRSAN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGL-------------------- 231
            |..||.:  |||.:|.:||.:...|..|.:.||:.:.|..|.:.|                    
Human   225 KVPRSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAAGSGKKAAAGAQAS 289

  Fly   232 -----------SVDDASTDSP----SP---------------PPLDLTTP---PPPSSQSALQLS 263
                       |...|.|:||    ||               |...|:.|   |.|..|......
Human   290 QAQLGEAAGPASETPAGTESPHSSASPCQEHKRGGLGELKGTPAAALSPPEPAPSPGQQQQAAAH 354

  Fly   264 ALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEA-------NNLDQTIQPTQLQQPHSH 321
            .||.|:|             ||:    ||:..|..:...|       |||    ..::.|..|||
Human   355 LLGPPHH-------------PGL----PPEAHLKPEHHYAFNHPFSINNL----MSSEQQHHHSH 398

  Fly   322 HQH 324
            |.|
Human   399 HHH 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 43/85 (51%)
FOXA2NP_068556.2 Forkhead_N 23..164 CDD:369872 17/68 (25%)
FH_FOXA2 163..264 CDD:410813 47/100 (47%)
HNF_C 380..452 CDD:401339 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.