DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxj3

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001101441.1 Gene:Foxj3 / 313554 RGDID:1311770 Length:622 Species:Rattus norvegicus


Alignment Length:330 Identity:97/330 - (29%)
Similarity:144/330 - (43%) Gaps:77/330 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 HGSGSLPSVNRMAALSTISLFPQT----QRIFQPEEPKPQHSYIGLIAMAILSSTDMKLVLSDIY 156
            ||:|    :::..||    |.|.|    :.:.|.::.||.:||..||..||.||...|:.||:||
  Rat    49 HGTG----ISKKNAL----LDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIY 105

  Fly   157 QYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWAIHPANMEDFRKGDFRRR 219
            |:|.||:||:|..|.||:||||||||||.||:|..||.:  |||.||||.....||..  ..|.:
  Rat   106 QWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDTL--PTRPK 168

  Fly   220 KAQRKV-RKHMGLSVDDAS-------TDSPSP-----------------------PPLDLTTPPP 253
            |..|.| |.....|:|..|       :.|.||                       |...|.....
  Rat   169 KRARSVERASTPYSIDSDSLGMECIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLS 233

  Fly   254 PSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEANNLDQTIQPTQLQQP 318
            ..|.:::.|:::|..:           |..|...|..|...:|..|:|...||     |.:.:|.
  Rat   234 DQSLASVNLNSVGSVH-----------SYTPVTNHPEPVSQSLTPQQQPQYNL-----PERDKQL 282

  Fly   319 HSHHQHFAYINSTTTTTIANMFSQTRKRQFDVASLLAPDVQIVDIVSEDQESSVTPTT---SART 380
            .....:|..::::..:...::|.|:..:|           .::.|.||..:.|.|..:   |..:
  Rat   283 LFTEYNFEDLSASFRSLYKSVFEQSLSQQ-----------GLMSIPSESSQQSHTSCSYQHSPSS 336

  Fly   381 TTQTH 385
            |..:|
  Rat   337 TVTSH 341

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 49/85 (58%)
Foxj3NP_001101441.1 COG5025 <54..345 CDD:227358 94/321 (29%)
FH_FOXJ3 77..155 CDD:410826 46/77 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.