DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxa3

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_571374.1 Gene:foxa3 / 30559 ZFINID:ZDB-GENE-980526-423 Length:441 Species:Danio rerio


Alignment Length:307 Identity:94/307 - (30%)
Similarity:135/307 - (43%) Gaps:55/307 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 GSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQP-----EEPKPQHSYIGLIA 139
            ||.||.    |.|..|:.|...| :::::..|..|| .:|:.:.:|     ...||.:|||.||.
Zfish    95 GSSAST----LGPLSHYQSMGQP-MSQISYPSPTSL-NRTKEMPKPYRRSLTHAKPPYSYISLIT 153

  Fly   140 MAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWA 202
            |||..|....|.|::|||:|:|.:||:|.....|:|||||:||.||||:|..||.:  |||.|||
Zfish   154 MAIQQSQSKMLTLNEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSYWA 218

  Fly   203 IHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPL----DLTTPPPPSSQSALQLS 263
            :||.:...|..|.:.||:.:.|:.:..|......|.|..|....    .:.....|::.|....|
Zfish   219 LHPNSGNMFENGCYLRRQKRFKIEEKAGKKSSSKSQDGSSTKGTHSSEGMQEEHSPTTGSDGAES 283

  Fly   264 ALGYPYH--------QHYIGQFFNRSSAPGMTHYSP-PDPALL----------MQRQEANN---- 305
            |.....|        |..:.|....|.||.:.|.|| |.|:.:          :..|...|    
Zfish   284 AHSDSSHAGSTSEEQQRSLVQLDCPSQAPNLLHSSPVPIPSSVSASMPPSSSHLHSQGMGNSPHL 348

  Fly   306 -------LDQTIQPTQLQQPHSHHQHFAYINSTTTTTIANMFSQTRK 345
                   ||....|.:...||.:..|        ..:|.|:.|..:|
Zfish   349 LGSPMHHLDLQNDPLKSMDPHFNFNH--------PFSITNLMSNEQK 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
foxa3NP_571374.1 Forkhead_N 17..142 CDD:254796 14/52 (27%)
FH 143..231 CDD:214627 45/87 (52%)
HNF_C 374..>408 CDD:286443 5/22 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.