DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxd3

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_571365.2 Gene:foxd3 / 30548 ZFINID:ZDB-GENE-980526-143 Length:371 Species:Danio rerio


Alignment Length:291 Identity:88/291 - (30%)
Similarity:128/291 - (43%) Gaps:87/291 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRS 193
            ||.:|||.||.||||.|...||.||.|.::|.:.:||:|.:.|.|:|||||||||||||:|..|.
Zfish    96 KPPYSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPRE 160

  Fly   194 AN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPLDLTTPPPPSS 256
            ..  |||:||.:.|.:.:.|..|.|.||:  ::.::|.                     |.....
Zfish   161 PGNPGKGNYWTLDPQSEDMFDNGSFLRRR--KRFKRHQ---------------------PDILRD 202

  Fly   257 QSALQLSA-----LGYPYHQHYIGQFFNRSSAPGM-----TH-------YSPP-----DPAL-LM 298
            |:||.:.:     :|.||.:||           |:     ||       |.||     .||: |:
Zfish   203 QTALMMQSFGAYGIGNPYGRHY-----------GIHPAAYTHPAALQYPYIPPVGPMLPPAVPLL 256

  Fly   299 QRQEANN--LDQTIQPT-QLQQPHSHHQHFAYINSTTTTTIANMFSQTRKRQFDVASL------- 353
            ...|.|.  ....:.|: |||           :||.:|.:|......:|. .|.:.::       
Zfish   257 PSAELNRKAFSSQLSPSLQLQ-----------LNSLSTASIIKSEPSSRP-SFSIENIIGVSSSS 309

  Fly   354 ------LAPDVQIVDIVSEDQESSVTPTTSA 378
                  |.|.|.:...:...|..|:|.|::|
Zfish   310 TSAQTFLRPPVTVQSALLSAQSLSLTRTSAA 340

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
foxd3NP_571365.2 Forkhead 96..182 CDD:278670 45/85 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.