DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxk2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_006247952.1 Gene:Foxk2 / 303753 RGDID:1305408 Length:650 Species:Rattus norvegicus


Alignment Length:439 Identity:126/439 - (28%)
Similarity:166/439 - (37%) Gaps:142/439 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KPSLPNIYPLGTTRTSQAQSTTMTLEQYRLQLYNYALNIERLRCPQYGGTGGSGASAPWLHLSPY 93
            ||..|:|.||           |:.:......|      |..|..|.  ||..:..|.|   .||.
  Rat   164 KPVQPHISPL-----------TINIPDTMAHL------ISPLPSPT--GTISAANSCP---SSPR 206

  Fly    94 GHHGSG-----SLPS-VNRMAALSTISLFPQTQRIFQPE-------------EPKPQHSYIGLIA 139
            |...||     .:|| :|.||..|            |||             :.||.:||..||.
  Rat   207 GAGSSGYKMGRVIPSDLNLMADNS------------QPENEKEASGGDSPKDDSKPPYSYAQLIV 259

  Fly   140 MAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWA 202
            .||..:.|.:|.|:.||.:|..||||:|:...||:||||||||||..|||..||..  |||.:|.
  Rat   260 QAITMAPDKQLTLNGIYTHITKNYPYYRTADKGWQNSIRHNLSLNRYFIKVPRSQEEPGKGSFWR 324

  Fly   203 IHPANMEDFRKGDFRRRK--------------AQRKV---RKHMG-LSVDDASTDSP-------S 242
            |.||:.....:..||:|:              :.|..   ..|.| ||...:...:|       |
  Rat   325 IDPASESKLVEQAFRKRRPRGVPCFRTPLGPLSSRSAPASPNHAGVLSAHSSGAQTPESLSREGS 389

  Fly   243 PPPLDLTTPPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEANNLD 307
            |.||:   |.|.:||..|.:           |.:.....||||....|.| ..:.:|||    |.
  Rat   390 PAPLE---PEPGASQPKLAV-----------IQEARFAQSAPGSPLSSQP-VLITVQRQ----LP 435

  Fly   308 QTIQPTQLQQPHSHHQHFAYINSTTTTTIANMFSQTRKRQFDVASLLAPDVQIVDIVSEDQESSV 372
            ..|:|               :..|..|.:....||            .|.||.|.:|.:....:|
  Rat   436 PAIKP---------------VTYTVATPVTTPTSQ------------PPVVQTVHVVHQIPAVAV 473

  Fly   373 TPTTS---ARTTTQTHHTVITKQTI------------HREVVLGLEKPV 406
            |....   |.|.|.....|:|:..:            ||||.:.:| ||
  Rat   474 TSVAGLAPANTYTVAGQAVVTQAAVLAPKTEPQENGDHREVRVKVE-PV 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 43/85 (51%)
Foxk2XP_006247952.1 FHA 41..145 CDD:238017
Forkhead 249..335 CDD:278670 43/85 (51%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.