DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxh1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_008763787.1 Gene:Foxh1 / 300054 RGDID:1311275 Length:416 Species:Rattus norvegicus


Alignment Length:232 Identity:59/232 - (25%)
Similarity:92/232 - (39%) Gaps:58/232 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 TISLFPQTQRIFQPEEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNS 176
            ::|..|:.::.......||.::|:.:||:              |.:.:...:|:||....||::|
  Rat    76 SLSKTPKRRKKRYLRHDKPPYTYLAMIAL--------------IIRQVQAVFPFFRDDYEGWKDS 126

  Fly   177 IRHNLSLNDCFIKSGR---SANGKGHYWAIH----PANMEDFRKGDFRRRKAQRKVRKHMGLSVD 234
            ||||||.|.||.|..:   ....||::||:.    ||.....:.....||...|..  |...:.|
  Rat   127 IRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEALRLQNTALCRRWQNRGT--HRAFAKD 189

  Fly   235 DAS---TDSPSPPPLDLTTPPPPSSQSALQLSALG-------YPYHQHYIGQFFNRSSAPGMTHY 289
            .:.   ...|..||    :|||||.:.....|.||       :|.|....||             
  Rat   190 LSPYVLHGQPYRPP----SPPPPSREDFSIKSLLGDPGKASTWPQHPRLAGQ------------- 237

  Fly   290 SPPDPALLMQRQE-------ANNLDQTIQP-TQLQQP 318
            |.|..|..:.:.|       :|..|:.:.| :.|.:|
  Rat   238 STPAQASTLSKGEEGIGAGPSNVSDKPLWPLSSLPRP 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 28/90 (31%)
Foxh1XP_008763787.1 FH 93..157 CDD:294049 26/77 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.