DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxd3

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_008762182.2 Gene:Foxd3 / 29203 RGDID:621715 Length:469 Species:Rattus norvegicus


Alignment Length:254 Identity:80/254 - (31%)
Similarity:110/254 - (43%) Gaps:74/254 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GG----TGGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEP-----KPQ 131
            ||    |||.|..|        |...:|.|                      .|.:|     ||.
  Rat    99 GGEDAVTGGGGPGA--------GGGATGGL----------------------TPNKPKNSLVKPP 133

  Fly   132 HSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN- 195
            :|||.||.||||.|...||.||.|.::|.:.:||:|.:.|.|:|||||||||||||:|..|... 
  Rat   134 YSYIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGN 198

  Fly   196 -GKGHYWAIHPANMEDFRKGDF--RRRKAQRKVRKHM------------GLSVDDASTDSPSPPP 245
             |||:||.:.|.:.:.|..|.|  ||::.:|..::|:            ..|:..|::..|...|
  Rat   199 PGKGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQQEHLREQTALMMQSFGAYSLAAAASAGPYGRP 263

  Fly   246 LDL-------TTPPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALL 297
            ..|       ....|.::.:|...:||.|||            :.|.:....||...||
  Rat   264 YGLHPAAAAGAYSHPAAAAAAAAAAALQYPY------------ALPPVAPVLPPAVPLL 310

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
Foxd3XP_008762182.2 FH_FOXD3 130..226 CDD:410821 49/95 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.