DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXD3

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_036315.1 Gene:FOXD3 / 27022 HGNCID:3804 Length:478 Species:Homo sapiens


Alignment Length:253 Identity:85/253 - (33%)
Similarity:110/253 - (43%) Gaps:68/253 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GGTGG--SGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEP-----KPQHS 133
            ||.||  .|||.        |..|:|| .|...:|                |.:|     ||.:|
Human   106 GGVGGEEGGASG--------GGPGAGS-GSAGGLA----------------PSKPKNSLVKPPYS 145

  Fly   134 YIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--G 196
            ||.||.||||.|...||.||.|.::|.:.:||:|.:.|.|:|||||||||||||:|..|...  |
Human   146 YIALITMAILQSPQKKLTLSGICEFISNRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPG 210

  Fly   197 KGHYWAIHPANMEDFRKGDF-RRRK-----AQRKVRKHMGLSVDD---------ASTDSPSPPPL 246
            ||:||.:.|.:.:.|..|.| ||||     .|..:|:...|.:..         |....|...|.
Human   211 KGNYWTLDPQSEDMFDNGSFLRRRKRFKRHQQEHLREQTALMMQSFGAYSLAAAAGAAGPYGRPY 275

  Fly   247 DL-------TTPPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALL 297
            .|       ....|.::.:|...:||.|||            :.|.:....||...||
Human   276 GLHPAAAAGAYSHPAAAAAAAAAAALQYPY------------ALPPVAPVLPPAVPLL 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
FOXD3NP_036315.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..136 14/54 (26%)
Forkhead 141..227 CDD:278670 45/85 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.