DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxl2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_036150.1 Gene:Foxl2 / 26927 MGIID:1349428 Length:375 Species:Mus musculus


Alignment Length:277 Identity:80/277 - (28%)
Similarity:109/277 - (39%) Gaps:92/277 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PEEP----KPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLND 185
            ||:|    ||.:||:.||||||..|.:.:|.||.|||||:..:|::.....||:||||||||||:
Mouse    42 PEKPDPAQKPPYSYVALIAMAIRESAEKRLTLSGIYQYIIAKFPFYEKNKKGWQNSIRHNLSLNE 106

  Fly   186 CFIKSGRSANG--KGHYWAIHPANMEDFRKGDFRRRKAQRKVRK----HM--------------G 230
            ||||..|...|  ||:||.:.||..:.|.||::|||:..::..:    |.              |
Mouse   107 CFIKVPREGGGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPPAHFQPGKGLFGSGGAAGG 171

  Fly   231 LSVDDASTDS---PSPPPL----------DLTTPPPPSSQSALQLSALGY--------------- 267
            ..|..|..|.   .:||..          .|..||.|...::.|::|...               
Mouse   172 CGVPGAGADGYGYLAPPKYLQSGFLNNSWPLPQPPSPMPYASCQMAAAAAAAAAAAAAAGPGSPG 236

  Fly   268 ----------------PYHQHY-------IGQFFNRSSAPGMTHYSPPDPALLMQRQEANNLDQT 309
                            ||.:..       :...:|....|......||.|               
Mouse   237 AAAVVKGLAGPAASYGPYSRVQSMALPPGVVNSYNGLGGPPAAPPPPPPP--------------- 286

  Fly   310 IQPTQLQQPHSHHQHFA 326
              |.....||:||.|.|
Mouse   287 --PHPHPHPHAHHLHAA 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
Foxl2NP_036150.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..50 3/7 (43%)
FH 50..138 CDD:214627 46/87 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 272..341 11/47 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2255
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.