DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxd4

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_001055972.2 Gene:Foxd4 / 252886 RGDID:621716 Length:432 Species:Rattus norvegicus


Alignment Length:231 Identity:76/231 - (32%)
Similarity:104/231 - (45%) Gaps:64/231 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 PEEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIK 189
            |:..||.:|||.||.||||.|...:|.||.|..:|...:||:|.:.|.|:|||||||||||||:|
  Rat    99 PQPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVK 163

  Fly   190 SGRSAN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPLDLTTP- 251
            ..|...  |||:||::.||:.:.|..|.|.||:  ::.::|             .|||..  .| 
  Rat   164 IPREPGHPGKGNYWSLDPASQDMFDNGSFLRRR--KRFKRH-------------HPPPGG--HPH 211

  Fly   252 ---PPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHY-----SPP---------------- 292
               |||:..:.:|:|..|          ...|.|||...:.     |||                
  Rat   212 CPFPPPAVPATVQVSQPG----------LLLRYSAPPQPNLAVHPASPPRSRPCAPLHPYPLRYL 266

  Fly   293 ---DPALLMQRQEANNLD-------QTIQPTQLQQP 318
               .||...:.::|...|       ..:||....||
  Rat   267 LLAAPAYADEPRKAEGADPATSLAIPALQPAPGSQP 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
Foxd4XP_001055972.2 Forkhead 103..189 CDD:278670 45/85 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.