DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxa3

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_038957314.1 Gene:Foxa3 / 25100 RGDID:2809 Length:361 Species:Rattus norvegicus


Alignment Length:280 Identity:90/280 - (32%)
Similarity:116/280 - (41%) Gaps:82/280 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GTGGS----GASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEPKPQHSYIGL 137
            |||||    ||..|.|      .||........|..|                 ..||.:|||.|
  Rat    93 GTGGSASGYGAPGPGL------VHGKEMAKGYRRPLA-----------------HAKPPYSYISL 134

  Fly   138 IAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHY 200
            |.|||..:....|.||:|||:|:|.:||:|.....|:|||||:||.||||:|..||.:  |||.|
  Rat   135 ITMAIQQAPGKMLTLSEIYQWIMDLFPYYRENQQRWQNSIRHSLSFNDCFVKVARSPDKPGKGSY 199

  Fly   201 WAIHPANMEDFRKGDFRRR----KAQRKVRKHMGLSVDDASTD------------------SPSP 243
            ||:||::...|..|.:.||    |.:.|.:|  |.|...|:.:                  ||:.
  Rat   200 WALHPSSGNMFENGCYLRRQKRFKLEEKAKK--GNSATSATRNGTVGSATSATTTAATAVTSPAQ 262

  Fly   244 PPLDLTTPPPPSSQSALQLSAL-------GYPYHQHYIGQFFNRSSAPGMTHYSPP----DPALL 297
            |  ..|.|..|.:||...:..|       ..||        |.....||......|    .|..:
  Rat   263 P--QPTPPSEPEAQSGEDVGGLDCASPPSSAPY--------FTGLELPGELKLDAPYNFNHPFSI 317

  Fly   298 MQRQEANNL--DQTIQPTQL 315
                  |||  :||..|::|
  Rat   318 ------NNLMSEQTSTPSKL 331

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
Foxa3XP_038957314.1 FH_FOXA3 124..225 CDD:410814 49/100 (49%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.