DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxa2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_006235201.1 Gene:Foxa2 / 25099 RGDID:2808 Length:465 Species:Rattus norvegicus


Alignment Length:326 Identity:93/326 - (28%)
Similarity:135/326 - (41%) Gaps:98/326 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GGTGGSGASAPWLH----LSPYGHHGSGSLPSVNRMAALSTIS-LFPQT--QRIFQPE------- 126
            |..|.:|.:....|    |||.|...:|::..:...|.::::| ::.|.  .|...|:       
  Rat    98 GSAGAAGVAGMGPHLSPSLSPLGGQAAGAMGGLAPYANMNSMSPMYGQAGLSRARDPKTYRRSYT 162

  Fly   127 EPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSG 191
            ..||.:|||.||.|||..|.:..|.||:|||:|:|.:|::|.....|:|||||:||.||||:|..
  Rat   163 HAKPPYSYISLITMAIQQSPNKMLTLSEIYQWIMDLFPFYRQNQQRWQNSIRHSLSFNDCFLKVP 227

  Fly   192 RSAN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGL----------------------- 231
            ||.:  |||.:|.:||.:...|..|.:.||:.:.|..|.:.|                       
  Rat   228 RSPDKPGKGSFWTLHPDSGNMFENGCYLRRQKRFKCEKQLALKEAAGAGSGGGKKTAPGTQASQV 292

  Fly   232 ---------SVDDASTDSP----SP--------------PPLDLTTPPPPSSQSALQLSALGY-- 267
                     |...|.|:||    ||              .|....:||.|:.....|..|..:  
  Rat   293 QLGEAAGSASETPAGTESPHSSASPCQEHKRGGLSELKGTPASALSPPEPAPSPGQQQQAAAHLL 357

  Fly   268 --PYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEA-------NNLDQTIQPTQLQQPHSHHQ 323
              |:|             ||:    ||:..|..:...|       |||    ..::.|..||||.
  Rat   358 VPPHH-------------PGL----PPEAHLKPEHHYAFNHPFSINNL----MSSEQQHHHSHHH 401

  Fly   324 H 324
            |
  Rat   402 H 402

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 43/85 (51%)
Foxa2XP_006235201.1 Forkhead_N 23..164 CDD:254796 14/65 (22%)
FH 165..253 CDD:214627 43/87 (49%)
HNF_C 381..454 CDD:286443 9/26 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.