DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxi2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_341950.2 Gene:Foxi2 / 246073 RGDID:621739 Length:337 Species:Rattus norvegicus


Alignment Length:234 Identity:84/234 - (35%)
Similarity:114/234 - (48%) Gaps:51/234 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PQYGGTG-GSGASAPWLH---LSPYGHHG---------------SGSL--PSVNRMAA-LSTISL 115
            |.||... |||... |::   |||..:..               ||||  ||.....| |:.:||
  Rat    51 PSYGRADLGSGRRL-WVNSTALSPAPYTPGPGPAPTYAAAALAVSGSLLSPSGGLAGADLAWLSL 114

  Fly   116 FPQTQRIFQPEEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHN 180
            ..|.:.:   ...:|.:||..||||||.|:...:|.||.||||:..|:|:::....||:||||||
  Rat   115 SGQQELL---RLVRPPYSYSALIAMAIQSAPLRRLTLSQIYQYVAGNFPFYKRSKAGWQNSIRHN 176

  Fly   181 LSLNDCFIKSGRSAN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSP 243
            |||||||.|..|..|  |||:||.:.|...:.|..|:|||::.:|.       ...:|:....|.
  Rat   177 LSLNDCFKKVPRDENDPGKGNYWTLDPNCEKMFDNGNFRRKRRRRG-------ETSEAAVPGASR 234

  Fly   244 P------PLDL------TTPPPPSSQSALQLS----ALG 266
            |      |..|      |:|.|.:.::|..||    |||
  Rat   235 PERAALEPSGLVSQDLQTSPSPTAPEAAACLSSFSTALG 273

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/85 (52%)
Foxi2XP_341950.2 Forkhead 125..211 CDD:278670 44/85 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.