DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxi3

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001094934.1 Gene:Foxi3 / 232077 MGIID:3511278 Length:399 Species:Mus musculus


Alignment Length:346 Identity:99/346 - (28%)
Similarity:137/346 - (39%) Gaps:99/346 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    77 GTGGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIF------QPEEP------- 128
            |.||..::|.:|. :|....|:...|.:...||..|   |...||.|      .|..|       
Mouse    51 GVGGPASAASYLG-APPPPPGAAPGPFLQPPAAPGT---FAGAQRGFAQPSASAPASPAGSAAPG 111

  Fly   129 -----------------KPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNS 176
                             :|.:||..||||||.|:.:.||.||.|||::.||:|:::....||:||
Mouse   112 ELGWLSMASREDLMKMVRPPYSYSALIAMAIQSAPERKLTLSHIYQFVADNFPFYQRSKAGWQNS 176

  Fly   177 IRHNLSLNDCFIKSGRSAN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDAST- 238
            |||||||||||.|..|..:  |||:||.:.|...:.|..|:| |||.:|:......|:|...:: 
Mouse   177 IRHNLSLNDCFKKVPRDEDDPGKGNYWTLDPNCEKMFDNGNF-RRKRRRRAEASSNLTVPSGTSK 240

  Fly   239 ----------------DSPSPPPLDLTTPPPP-------SSQSALQLSALGYPYHQHYIGQF--- 277
                            ||||.......:|.||       ||..|..|::.  |....::..|   
Mouse   241 SEGQSSRLRVSGKLEGDSPSSILRPSQSPEPPEGTKSTASSPGASTLTST--PCLNTFLSTFNTL 303

  Fly   278 -FNRSSA-------PGMTHY------------------SPPDPALLMQRQEANNLDQTIQP---- 312
             .|.||:       ||...:                  |.||...|.....:|.|.....|    
Mouse   304 NVNSSSSMGNQRTLPGSRRHLGGTQLPSSTFPNTSVPDSSPDSMQLSTVGGSNQLSSYYNPFSGG 368

  Fly   313 ---TQLQQPHSHHQHFAYINS 330
               .|.....|...:|:.:||
Mouse   369 SSGDQSSPFSSPFYNFSMVNS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/85 (52%)
Foxi3NP_001094934.1 Forkhead 129..215 CDD:278670 44/85 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.