DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXS1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_004109.1 Gene:FOXS1 / 2307 HGNCID:3735 Length:330 Species:Homo sapiens


Alignment Length:225 Identity:73/225 - (32%)
Similarity:100/225 - (44%) Gaps:69/225 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 EEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKS 190
            |..||.:|||.||||||.||...:..||.||:||:..:.::|...|||:||||||||||:||:|.
Human    15 EPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHNLSLNECFVKV 79

  Fly   191 GRSAN--GKGHYWAIHPANMEDFRKGDF--RRRKAQR-----------KVRK------------- 227
            .|...  |||.||.:.|...:.|..|.|  |||:..|           |.|:             
Human    80 PRDDRKPGKGSYWTLDPDCHDMFEHGSFLRRRRRFTRQTGAEGTRGPAKARRGPLRATSQDPGVP 144

  Fly   228 ---------------------------HMGLSVDDASTDS-PSPP--PLDLTTPPP------PSS 256
                                       .|..|:..|:||. |.||  |.:::||.|      |.:
Human   145 NATTGRQCSFPPELPDPKGLSFGGLVGAMPASMCPATTDGRPRPPMEPKEISTPKPACPGELPVA 209

  Fly   257 QSALQLSALGYP--YHQHYIGQFFNRSSAP 284
            .|:....|.|:|  :.:   .:.||::..|
Human   210 TSSSSCPAFGFPAGFSE---AESFNKAPTP 236

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/85 (52%)
FOXS1NP_004109.1 Forkhead 18..103 CDD:306709 43/84 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 111..157 5/45 (11%)
DNA_pol3_gamma3 <116..313 CDD:331207 23/124 (19%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..200 9/20 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2255
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.770

Return to query results.
Submit another query.