Sequence 1: | NP_651951.1 | Gene: | fd102C / 43843 | FlyBaseID: | FBgn0039937 | Length: | 599 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_004109.1 | Gene: | FOXS1 / 2307 | HGNCID: | 3735 | Length: | 330 | Species: | Homo sapiens |
Alignment Length: | 225 | Identity: | 73/225 - (32%) |
---|---|---|---|
Similarity: | 100/225 - (44%) | Gaps: | 69/225 - (30%) |
- Green bases have known domain annotations that are detailed below.
Fly 126 EEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKS 190
Fly 191 GRSAN--GKGHYWAIHPANMEDFRKGDF--RRRKAQR-----------KVRK------------- 227
Fly 228 ---------------------------HMGLSVDDASTDS-PSPP--PLDLTTPPP------PSS 256
Fly 257 QSALQLSALGYP--YHQHYIGQFFNRSSAP 284 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd102C | NP_651951.1 | Forkhead | 129..213 | CDD:278670 | 44/85 (52%) |
FOXS1 | NP_004109.1 | Forkhead | 18..103 | CDD:306709 | 43/84 (51%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 111..157 | 5/45 (11%) | |||
DNA_pol3_gamma3 | <116..313 | CDD:331207 | 23/124 (19%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 179..200 | 9/20 (45%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S2255 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
5 | 4.770 |