DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXC2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_005242.1 Gene:FOXC2 / 2303 HGNCID:3801 Length:501 Species:Homo sapiens


Alignment Length:284 Identity:84/284 - (29%)
Similarity:114/284 - (40%) Gaps:102/284 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    75 YGG---------------TGGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQ 124
            |||               :.|.|.|     .:||.||                           |
Human    31 YGGMASPMGVYSGHPEQYSAGMGRS-----YAPYHHH---------------------------Q 63

  Fly   125 PEEP----KPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLND 185
            |..|    ||.:|||.||.|||.::.:.|:.|:.|||:|:|.:|::|....||:||||||||||:
Human    64 PAAPKDLVKPPYSYIALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNE 128

  Fly   186 CFIKSGRSAN--GKGHYWAIHPANMEDFRKGDFRRRK---------AQRKVRKHMGLSVDDASTD 239
            ||:|..|...  |||.||.:.|.:...|..|.|.||:         .:::.|.|:......||..
Human   129 CFVKVPRDDKKPGKGSYWTLDPDSYNMFENGSFLRRRRRFKKKDVSKEKEERAHLKEPPPAASKG 193

  Fly   240 SPSPPPL---------------DLTTPPPP--------SSQSALQLSALGYPYHQHYIGQFFNRS 281
            :|:.|.|               :..:|..|        |.:||||    |.|           ||
Human   194 APATPHLADAPKEAEKKVVIKSEAASPALPVITKVETLSPESALQ----GSP-----------RS 243

  Fly   282 SAPGMTHYSPPDPALLMQRQEANN 305
            :|  .|....||.:|......|.|
Human   244 AA--STPAGSPDGSLPEHHAAAPN 265

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 42/85 (49%)
FOXC2NP_005242.1 FH 72..160 CDD:214627 42/87 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 167..208 7/40 (18%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 232..268 16/51 (31%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 383..420
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.