DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXJ1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001445.2 Gene:FOXJ1 / 2302 HGNCID:3816 Length:421 Species:Homo sapiens


Alignment Length:248 Identity:79/248 - (31%)
Similarity:105/248 - (42%) Gaps:55/248 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 PLGTTRTSQAQSTTMTLEQYRLQLYNYALNIERLRCPQYGGTGGSGASAPWLHLSPYGHHG-SGS 100
            |.|......|...::|..|: ||.:: .||.:....|. |||            .|:|:|. .||
Human    19 PEGGLEEPDALDDSLTSLQW-LQEFS-ILNAKAPALPP-GGT------------DPHGYHQVPGS 68

  Fly   101 LPSVNRMAALSTISLFPQTQRIFQPEEP-----------------------------KPQHSYIG 136
            ....:.:||.......|.|     |.:|                             ||.:||..
Human    69 AAPGSPLAADPACLGQPHT-----PGKPTSSCTSRSAPPGLQAPPPDDVDYATNPHVKPPYSYAT 128

  Fly   137 LIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGH 199
            ||.||:.:|...|:.||.||::|.||:.|||...|.|:||||||||||.||||..|..:  |||.
Human   129 LICMAMQASKATKITLSAIYKWITDNFCYFRHADPTWQNSIRHNLSLNKCFIKVPREKDEPGKGG 193

  Fly   200 YWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDS--PSPPPLDLTT 250
            :|.|.|...|....|.|::|:.. .|..|...:...|...|  |...||.:.|
Human   194 FWRIDPQYAERLLSGAFKKRRLP-PVHIHPAFARQAAQEPSAVPRAGPLTVNT 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/85 (52%)
FOXJ1NP_001445.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..34 3/14 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 48..116 15/85 (18%)
Forkhead 121..205 CDD:306709 44/83 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 261..302
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.850

Return to query results.
Submit another query.