Sequence 1: | NP_651951.1 | Gene: | fd102C / 43843 | FlyBaseID: | FBgn0039937 | Length: | 599 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001445.2 | Gene: | FOXJ1 / 2302 | HGNCID: | 3816 | Length: | 421 | Species: | Homo sapiens |
Alignment Length: | 248 | Identity: | 79/248 - (31%) |
---|---|---|---|
Similarity: | 105/248 - (42%) | Gaps: | 55/248 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 37 PLGTTRTSQAQSTTMTLEQYRLQLYNYALNIERLRCPQYGGTGGSGASAPWLHLSPYGHHG-SGS 100
Fly 101 LPSVNRMAALSTISLFPQTQRIFQPEEP-----------------------------KPQHSYIG 136
Fly 137 LIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGH 199
Fly 200 YWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDS--PSPPPLDLTT 250 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd102C | NP_651951.1 | Forkhead | 129..213 | CDD:278670 | 44/85 (52%) |
FOXJ1 | NP_001445.2 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..34 | 3/14 (21%) | |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 48..116 | 15/85 (18%) | |||
Forkhead | 121..205 | CDD:306709 | 44/83 (53%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 261..302 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R2114 |
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.850 |