DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXL1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_005241.1 Gene:FOXL1 / 2300 HGNCID:3817 Length:345 Species:Homo sapiens


Alignment Length:290 Identity:87/290 - (30%)
Similarity:126/290 - (43%) Gaps:77/290 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 ASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEPKPQHSYIGLIAMAILSSTD 147
            |::|.|:|  ||....| ||.....||....|...:|.:       ||.:|||.||||||..:.:
Human    13 AASPMLYL--YGPERPG-LPLAFAPAAALAASGRAETPQ-------KPPYSYIALIAMAIQDAPE 67

  Fly   148 MKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWAIHPANMED 210
            .::.|:.|||:|:|.:|::.....||:|||||||||||||:|..|...  |||.||.:.|..::.
Human    68 QRVTLNGIYQFIMDRFPFYHDNRQGWQNSIRHNLSLNDCFVKVPREKGRPGKGSYWTLDPRCLDM 132

  Fly   211 FRKGDFRRRKAQRK------------VRKHM------------------GLSVDDASTDSPSPPP 245
            |..|::||||.:.|            ...|.                  .:|...|:...|| |.
Human   133 FENGNYRRRKRKPKPGPGAPEAKRPRAETHQRSAEAQPEAGSGAGGSGPAISRLQAAPAGPS-PL 196

  Fly   246 LDLTTPPPP---------------SSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPA 295
            ||..:||.|               ::|.|..::          :||.......||    ||..||
Human   197 LDGPSPPAPLHWPGTASPNEDAGDAAQGAAAVA----------VGQAARTGDGPG----SPLRPA 247

  Fly   296 -----LLMQRQEANNLDQTIQPTQLQQPHS 320
                 ....:.::.::|..:...|.|:|.|
Human   248 SRSSPKSSDKSKSFSIDSILAGKQGQKPPS 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 42/85 (49%)
FOXL1NP_005241.1 FH 49..137 CDD:214627 42/87 (48%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 136..289 32/157 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S2255
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.800

Return to query results.
Submit another query.