DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXI1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_036320.2 Gene:FOXI1 / 2299 HGNCID:3815 Length:378 Species:Homo sapiens


Alignment Length:332 Identity:98/332 - (29%)
Similarity:140/332 - (42%) Gaps:89/332 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NVPKPSLPNIYPLGTTRTSQAQSTTMTLEQYRLQLYN----YALNIERLRCPQYGGTGGSGAS-- 84
            ::|.||.|...|         |..::..|...:.||.    :...:...:.|.:.|.|..||:  
Human     5 DLPAPSPPRCSP---------QFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPN 60

  Fly    85 ------------APWL---HLSPYGHHGSG----SLPSVNRMAALSTISLFPQTQRIFQPEE--- 127
                        .|:|   :.||:.....|    .||||:.:.. |.:...|    |...||   
Human    61 PYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVSGLGG-SDLGWLP----IPSQEELMK 120

  Fly   128 -PKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSG 191
             .:|.:||..||||||..:.|.:|.||.||||:.||:|::.....||:|||||||||||||.|..
Human   121 LVRPPYSYSALIAMAIHGAPDKRLTLSQIYQYVADNFPFYNKSKAGWQNSIRHNLSLNDCFKKVP 185

  Fly   192 RSAN--GKGHYWAIHPANMEDFRKGDFRRRKAQRK-----------VRKHMGLSVDDASTDSPSP 243
            |..:  |||:||.:.|...:.|..|:|||::.::.           .:....|.||...|..|. 
Human   186 RDEDDPGKGNYWTLDPNCEKMFDNGNFRRKRKRKSDVSSSTASLALEKTESSLPVDSPKTTEPQ- 249

  Fly   244 PPLDLTTP------------PPPSSQSALQ--LSAL------GYPYHQHYIGQFFNRSSAPGMTH 288
            ..||..:|            ||||....|.  ||::      |.|            :|.|.:|.
Human   250 DILDGASPGGTTSSPEKRPSPPPSGAPCLNSFLSSMTAYVSGGSP------------TSHPLVTP 302

  Fly   289 YSPPDPA 295
            ...|:|:
Human   303 GLSPEPS 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/85 (52%)
FOXI1NP_036320.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..26 7/29 (24%)
FH 123..211 CDD:214627 44/87 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 208..278 16/70 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.