DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXJ3

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_005270689.1 Gene:FOXJ3 / 22887 HGNCID:29178 Length:630 Species:Homo sapiens


Alignment Length:330 Identity:98/330 - (29%)
Similarity:145/330 - (43%) Gaps:77/330 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 HGSGSLPSVNRMAALSTISLFPQT----QRIFQPEEPKPQHSYIGLIAMAILSSTDMKLVLSDIY 156
            ||:|    :::..||    |.|.|    :.:.|.::.||.:||..||..||.||...|:.||:||
Human    57 HGTG----ISKKNAL----LDPNTTLDQEEVQQHKDGKPPYSYASLITFAINSSPKKKMTLSEIY 113

  Fly   157 QYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWAIHPANMEDFRKGDFRRR 219
            |:|.||:||:|..|.||:||||||||||.||:|..||.:  |||.||||.....||..  ..|.:
Human   114 QWICDNFPYYREAGSGWKNSIRHNLSLNKCFLKVPRSKDDPGKGSYWAIDTNPKEDVL--PTRPK 176

  Fly   220 KAQRKV-RKHMGLSVDDAS-------TDSPSP-----------------------PPLDLTTPPP 253
            |..|.| |.....|:|..|       :.|.||                       |...|.....
Human   177 KRARSVERASTPYSIDSDSLGMECIISGSASPTLAINTVTNKVTLYNTDQDGSDSPRSSLNNSLS 241

  Fly   254 PSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEANNLDQTIQPTQLQQP 318
            ..|.:::.|:::|..:           |..|..:|......:|..|:|...||     |.:.:|.
Human   242 DQSLASVNLNSVGSVH-----------SYTPVTSHPESVSQSLTPQQQPQYNL-----PERDKQL 290

  Fly   319 HSHHQHFAYINSTTTTTIANMFSQTRKRQFDVASLLAPDVQIVDIVSEDQESSVTPTT---SART 380
            .....:|..::::..:...::|.|:..:|           .:::|.||..:.|.|..|   |..:
Human   291 LFSEYNFEDLSASFRSLYKSVFEQSLSQQ-----------GLMNIPSESSQQSHTSCTYQHSPSS 344

  Fly   381 TTQTH 385
            |..||
Human   345 TVSTH 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 49/85 (58%)
FOXJ3XP_005270689.1 Forkhead 86..163 CDD:278670 46/76 (61%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.