DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXK1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001032242.1 Gene:FOXK1 / 221937 HGNCID:23480 Length:733 Species:Homo sapiens


Alignment Length:312 Identity:99/312 - (31%)
Similarity:135/312 - (43%) Gaps:52/312 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   126 EEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKS 190
            :|.||..||..||..||.|:.|.:|.||.||.:|..:|||:|:...||:||||||||||..|||.
Human   302 DESKPPFSYAQLIVQAISSAQDRQLTLSGIYAHITKHYPYYRTADKGWQNSIRHNLSLNRYFIKV 366

  Fly   191 GRSAN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKV---RKHMGLSVDDASTDSPSPPPLDLTT 250
            .||..  |||.:|.|.||:.....:..||:|: ||.|   |...|.....::..||:.|  .|.:
Human   367 PRSQEEPGKGSFWRIDPASEAKLVEQAFRKRR-QRGVSCFRTPFGPLSSRSAPASPTHP--GLMS 428

  Fly   251 PPPPSSQSALQLSALGYPY-HQHYIG-------QFFNRSSAPG-------MTHYSPPDPALLMQR 300
            |.....|:...||..|.|. |....|       ::....||||       :....||.|:.|:.:
Human   429 PRSGGLQTPECLSREGSPIPHDPEFGSKLASVPEYRYSQSAPGSPVSAQPVIMAVPPRPSSLVAK 493

  Fly   301 QEANNLDQTIQPTQL---QQPHSHHQHFAYINSTTT-----TTIAN------MFSQ-TRKRQFDV 350
            ..|      ..|..:   |||..|..|......|.|     ||.||      :.|| ......|.
Human   494 PVA------YMPASIVTSQQPAGHAIHVVQQAPTVTMVRVVTTSANSANGYILTSQGAAGGSHDA 552

  Fly   351 ASLLAPDVQIVDIVSEDQESSVTPTTSARTTTQTHHTVITKQTIHREVVLGL 402
            |.     ..::|:.||.:.....||.:..|.......:   ||:..::..|:
Human   553 AG-----AAVLDLGSEARGLEEKPTIAFATIPAAGGVI---QTVASQMAPGV 596

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/85 (52%)
FOXK1NP_001032242.1 Interaction with SIN3A and SIN3B. /evidence=ECO:0000250|UniProtKB:P42128 2..40
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 36..79
Required for interaction with FOXO4 and MEF2C. /evidence=ECO:0000250|UniProtKB:P42128 95..420 53/118 (45%)
FHA <102..204 CDD:224630
FHA 110..203 CDD:238017
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 287..306 1/3 (33%)
Forkhead 305..391 CDD:278670 44/85 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 413..436 5/24 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 676..733
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.