DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and FOXD4L1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_036316.1 Gene:FOXD4L1 / 200350 HGNCID:18521 Length:408 Species:Homo sapiens


Alignment Length:412 Identity:108/412 - (26%)
Similarity:157/412 - (38%) Gaps:119/412 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 NVPKPSLPNIYPLGTTRTSQAQSTTMTL--------------EQYRLQLYNYALNIERLRCPQYG 76
            |:|:...|...|..:.|.|..:...:.:              |:...:....:|. ..|:..::|
Human     2 NLPRAERPRSTPQRSLRDSDGEDGKIDVLGEEEDEDEVEDEEEEASQKFLEQSLQ-PGLQVARWG 65

  Fly    77 GTG-------GSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEPKPQHSY 134
            |..       |.|.|.|    |.:|    ....:..|.||.|..:..|          .||.:||
Human    66 GVALPREHIEGGGPSDP----SEFG----TEFRAPPRSAAASEDARQP----------AKPPYSY 112

  Fly   135 IGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GK 197
            |.||.||||.|...:|.||.|..:|...:||:|.:.|.|:|||||||||||||:|..|...  ||
Human   113 IALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNLSLNDCFVKIPREPGHPGK 177

  Fly   198 GHYWAIHPANMEDFRKGDFRRRKAQRKVRKH-----------MGLSVDDASTDSPSPPPL----D 247
            |.||::.||:.:.|..|.|.||:  ::.::|           ..|....|:..:|.|.||    .
Human   178 GTYWSLDPASQDMFDNGSFLRRR--KRFKRHQLTPGAHLPHPFPLPAAHAALHNPRPGPLLGAPA 240

  Fly   248 LTTPPP---PSSQSALQLSALGYPYHQHYIGQFFNRSSAP------------------------- 284
            |..|.|   |::....:..||.:|:...|:     ..|||                         
Human   241 LPQPVPGAYPNTAPGRRPYALLHPHPPRYL-----LLSAPAYAGAPKKAEGADLATPGTLPVLQP 300

  Fly   285 ---------GMTHYSPPDPAL-------LMQ--RQEANNLDQTIQPTQ------LQQPHSHHQHF 325
                     |....|||....       :||  |.......|::.||.      ||:|.|...:|
Human   301 SLGPQPWEEGKGLASPPGGGCISFSIESIMQGVRGAGTGAAQSLSPTAWSYCPLLQRPSSLSDNF 365

  Fly   326 AYINSTTTTTIANMFSQTRKRQ 347
            |   :|...:...:..:.|..|
Human   366 A---ATAAASGGGLRQRLRSHQ 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
FOXD4L1NP_036316.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..54 7/51 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 71..104 10/40 (25%)
Forkhead 107..193 CDD:278670 45/85 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 385..408 108/412 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.