DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and fkh-10

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_492676.2 Gene:fkh-10 / 182874 WormBaseID:WBGene00001442 Length:194 Species:Caenorhabditis elegans


Alignment Length:166 Identity:98/166 - (59%)
Similarity:122/166 - (73%) Gaps:9/166 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LPSVNRMAALSTISLFPQT--QRIFQP---EEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYIL 160
            |.|.|.....|...:.|.:  ..|..|   ::||||||||||||||||||...|:||:::|::|:
 Worm     9 LSSSNHSLKDSPFPMIPLSFDTSIMSPTECQQPKPQHSYIGLIAMAILSSPQKKMVLAEVYEWIM 73

  Fly   161 DNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSANGKGHYWAIHPANMEDFRKGDFRRRKAQRKV 225
            :.||||||||.||||||||||||||||:|:||:|||||||||:|||.::||.:||||||:|||||
 Worm    74 NEYPYFRSRGAGWRNSIRHNLSLNDCFVKAGRAANGKGHYWAVHPACVKDFERGDFRRRRAQRKV 138

  Fly   226 RKHMGLSVDDA-STDSPSPPPLDLTTPPPPSSQSAL 260
            |:||||.|:|. |:|....|..|   |.||...:||
 Worm   139 RRHMGLQVEDGDSSDEEGSPGSD---PSPPIFPTAL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 63/83 (76%)
fkh-10NP_492676.2 Forkhead 41..125 CDD:365978 63/83 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160163348
Domainoid 1 1.000 148 1.000 Domainoid score I2749
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 1 1.000 - - oto17699
orthoMCL 1 0.900 - - OOG6_109619
Panther 1 1.100 - - LDO PTHR11829
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1110.780

Return to query results.
Submit another query.