DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and fkh-9

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001024760.1 Gene:fkh-9 / 180670 WormBaseID:WBGene00001441 Length:300 Species:Caenorhabditis elegans


Alignment Length:299 Identity:95/299 - (31%)
Similarity:129/299 - (43%) Gaps:64/299 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 LPSVN---RMAALSTISLFP---QTQRIFQPEE--PKPQHSYIGLIAMAILSSTDMKLVLSDIYQ 157
            :||.:   ::...||||..|   ||.......:  .:|..||..||..||..|.:.:|.|::|||
 Worm    30 IPSASDTIKIETPSTISSQPSPIQTPLAAASSDNFERPSLSYKDLIIEAIDRSPEKRLKLNEIYQ 94

  Fly   158 YILDNYPYFRSRGP--GWRNSIRHNLSLNDCFIK---SGRSANG-KGHYWAIHPANMEDFRKGDF 216
            .|...:||:|.|..  ||:|||||||||:|||:|   ...||:| .||:|.:.| .:.|  |...
 Worm    95 VIRLLHPYYRHRPDQWGWQNSIRHNLSLHDCFVKLPLKQTSASGVVGHFWTVVP-ELSD--KQTL 156

  Fly   217 RRRKAQ------RKVRKHMGLSVDDASTD-----SPSPPPLDLTTP---PPPSSQSALQLSALGY 267
            |||..|      :|......||.||..:.     ||||....::.|   |.||.|:...|..|. 
 Worm   157 RRRNRQQPRALAKKSDAGRTLSRDDRGSSGSGETSPSPSQPSISPPNENPMPSVQALNVLELLS- 220

  Fly   268 PYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEANNLDQTIQPTQLQQPHSHHQHFAYINST- 331
             ....|.|..|..:....           |:|...|.|..|.:..|.|.|          ||.. 
 Worm   221 -GMNDYKGTLFQNNYRTN-----------LIQDNSAVNGLQNLLTTTLMQ----------INPQL 263

  Fly   332 -TTTTIANMFSQTRKRQFDVAS-LLAPDVQIVDIVSEDQ 368
             ...::||:.:.| ..|..:|| .|:|      |.:|.|
 Worm   264 GALLSLANLNNLT-TNQLQIASPSLSP------IKAESQ 295

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 41/89 (46%)
fkh-9NP_001024760.1 FH 66..153 CDD:214627 41/89 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.