DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and pes-1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001023406.1 Gene:pes-1 / 177267 WormBaseID:WBGene00003976 Length:264 Species:Caenorhabditis elegans


Alignment Length:345 Identity:91/345 - (26%)
Similarity:126/345 - (36%) Gaps:127/345 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 TSSRDSNVPK--------PSLPNIYPLGTTRTSQAQSTTMTLEQYRLQLYNYALNIERLRCPQYG 76
            |||..|:.|:        .|||...|    :|:...::.|.           ..||..| |....
 Worm     2 TSSIKSDAPQFLLDLDNCSSLPPTPP----KTASPGNSKMK-----------GFNISDL-CLDLD 50

  Fly    77 GTGGSGASAPWLHLSP----------YGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEP--K 129
            .:..|..|     :||          .|...||.    |...:.||             |.|  :
 Worm    51 SSTSSSCS-----VSPASSFHTRSESVGQQQSGR----NSPVSSST-------------ESPTKR 93

  Fly   130 PQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGP-GWRNSIRHNLSLNDCFIKSGRS 193
            |::||..||||||.||....|.:|:||:||..|:.|::::.| .|:||:||||||:..|.|. |:
 Worm    94 PKYSYNALIAMAIQSSPFKSLRVSEIYKYISSNFSYYKNQKPLQWQNSVRHNLSLHKEFRKV-RT 157

  Fly   194 ANGKGHYWA--------IHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPLDLTT 250
            .:|||.|||        ::.:|    ..|..||:|:  ||.|.               ||:....
 Worm   158 LDGKGSYWAMTADLGTDVYISN----NCGKLRRQKS--KVAKF---------------PPMQQHF 201

  Fly   251 PPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEANNLDQ------- 308
            |.|       ||....  .||              :...:|...|.|:|.....|:..       
 Worm   202 PIP-------QLPTQN--IHQ--------------LCMQNPQILATLLQNMYLQNMQNLQNIPMV 243

  Fly   309 --------TIQPTQLQQPHS 320
                    .|.||....|.|
 Worm   244 PGFPIIPVPINPTSFHFPKS 263

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 39/92 (42%)
pes-1NP_001023406.1 FH 93..168 CDD:238016 38/75 (51%)
rad23 <203..>240 CDD:273167 10/59 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.