DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and unc-130

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_496411.1 Gene:unc-130 / 174721 WormBaseID:WBGene00006853 Length:333 Species:Caenorhabditis elegans


Alignment Length:176 Identity:69/176 - (39%)
Similarity:94/176 - (53%) Gaps:31/176 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRS 193
            ||.:|||.||||:||:|.:.||.||:|.::|::.:.|::.:.|.|:|||||||||||||:|..|.
 Worm   127 KPPYSYIALIAMSILNSPEKKLTLSEICEFIINKFEYYKEKFPAWQNSIRHNLSLNDCFVKVARG 191

  Fly   194 AN--GKGHYWAIHPANMED-FRKGDF-RRRKAQRK-------VRKHMGLSVDDASTDSPSPPPLD 247
            ..  |||:|||:.| |.|| |..|.| ||||..:|       :..|..:         |.||.|.
 Worm   192 PGNPGKGNYWALDP-NCEDMFDNGSFLRRRKRYKKNSDTYHEMMSHHPM---------PFPPFLP 246

  Fly   248 LTTPPPPSSQSAL-QLSALGYPYHQHYIGQFFNRSSAPGMTHYSPP 292
            ...|.||.....: .:..||:|         .|..:.|.|..:..|
 Worm   247 QGMPFPPRMMHPMANIPMLGHP---------MNPRAVPNMPAFFIP 283

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 47/86 (55%)
unc-130NP_496411.1 COG5025 <126..330 CDD:227358 69/176 (39%)
Forkhead 127..212 CDD:365978 46/85 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.850

Return to query results.
Submit another query.