DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and let-381

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_491826.1 Gene:let-381 / 172331 WormBaseID:WBGene00002601 Length:362 Species:Caenorhabditis elegans


Alignment Length:148 Identity:62/148 - (41%)
Similarity:76/148 - (51%) Gaps:23/148 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 KPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIK---- 189
            ||..|||.||||||....|.|..|::||.|:.:|:.:||....|||||||||||||:||:|    
 Worm    72 KPPFSYIALIAMAISKRPDKKATLAEIYSYLQENFEFFRGEYAGWRNSIRHNLSLNECFVKLPKD 136

  Fly   190 SGRSANG-KGHYWAIHPANMEDFRKGDFRRRKAQRKVRK-----------HMGLSVDDASTDSPS 242
            :|.|..| |||.|.|..:......:..||||....|.||           .||  :..|:.|.||
 Worm   137 TGESYRGRKGHKWTISDSCEFMLEENGFRRRPRGYKARKRTHFPGVTASNEMG--IGGATFDYPS 199

  Fly   243 PPPLDLTTPPPPSSQSAL 260
            .     ||....|..|:|
 Worm   200 S-----TTELTDSGTSSL 212

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/88 (50%)
let-381NP_491826.1 Forkhead 71..160 CDD:365978 44/87 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11829
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.