DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxc2

DIOPT Version :10

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001095150.1 Gene:Foxc2 / 171356 RGDID:621703 Length:494 Species:Rattus norvegicus


Alignment Length:192 Identity:69/192 - (35%)
Similarity:91/192 - (47%) Gaps:51/192 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 QYGGTGGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEP----KPQHSY 134
            |||  .|.|.|     .:|| ||                           ||..|    ||.:||
  Rat    47 QYG--AGMGRS-----YAPY-HH---------------------------QPAAPKDLVKPPYSY 76

  Fly   135 IGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GK 197
            |.||.|||.::.:.|:.|:.|||:|:|.:|::|....||:||||||||||:||:|..|...  ||
  Rat    77 IALITMAIQNAPEKKITLNGIYQFIMDRFPFYRENKQGWQNSIRHNLSLNECFVKVPRDDKKPGK 141

  Fly   198 GHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPLDLTTPPPPSSQSA 259
            |.||.:.|.:...|..|.|.||:  |:.:|      .|...|...  ...|..|||.|::.|
  Rat   142 GSYWTLDPDSYNMFENGSFLRRR--RRFKK------KDVPKDKEE--RAHLKEPPPASAKGA 193

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 FH_FOXQ2-like 129..223 CDD:410809 46/95 (48%)
Foxc2NP_001095150.1 FH_FOXC1 66..158 CDD:410818 43/91 (47%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 166..213 9/36 (25%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 233..267
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 380..422
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.