DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxe3

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_599166.1 Gene:Foxe3 / 171302 RGDID:621727 Length:286 Species:Rattus norvegicus


Alignment Length:291 Identity:83/291 - (28%)
Similarity:116/291 - (39%) Gaps:97/291 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 PSLPNIYPLGTTRTSQAQSTTMTLEQYRLQLYNYALNIERLRCPQ--YGGTGGSGASAPWLHLSP 92
            |:||::.|.|....|.|..                   |..|.|:  .||......:||      
  Rat    11 PTLPSVSPSGPQPPSLAGD-------------------EPGREPEEVVGGGDSEPPAAP------ 50

  Fly    93 YGHHGSGSLPSVNRMAALSTISLFPQTQRIFQP-EEPKPQHSYIGLIAMAILSSTDMKLVLSDIY 156
                |.|                    :|..:| :..||.:|||.|||||:..:...:|.|:.||
  Rat    51 ----GPG--------------------RRRRRPLQRGKPPYSYIALIAMALAHAPGRRLTLAAIY 91

  Fly   157 QYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWAIHPANMEDFRKGDFRRR 219
            ::|.:.:.::|.....|:|||||||:|||||:|..|...  |||:||.:.||..:.|..|.|.||
  Rat    92 RFITERFAFYRDSPRKWQNSIRHNLTLNDCFVKVPREPGNPGKGNYWTLDPAAADMFDNGSFLRR 156

  Fly   220 KAQRKVRKHMGLSVDDASTDSPSPPPLDLTTPPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAP 284
            :.:.|            .|:.|:|       ||||            :||..      |..:.||
  Rat   157 RKRFK------------RTELPAP-------PPPP------------FPYAP------FPPAPAP 184

  Fly   285 GMTHYSPPDPALLMQRQEANNLDQTIQPTQL 315
                 :|..||.|.:......| ||..|..|
  Rat   185 -----APAPPARLFRLDSLLGL-QTEPPGPL 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 39/85 (46%)
Foxe3NP_599166.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..62 18/99 (18%)
FH 64..152 CDD:214627 39/87 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.