DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxa1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_032285.2 Gene:Foxa1 / 15375 MGIID:1347472 Length:468 Species:Mus musculus


Alignment Length:346 Identity:99/346 - (28%)
Similarity:143/346 - (41%) Gaps:54/346 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ADQDQGTSSRDSNVPKPSLPNIYPLGTTRTSQAQSTT--MTLEQYRLQLYNYALNIERLRCPQYG 76
            ||..:..||...:.....|.::..:.|..|....:|:  ||...:.:...|..|..........|
Mouse    20 ADTQEAYSSVPVSNMNSGLGSMNSMNTYMTMNTMTTSGNMTPASFNMSYANTGLGAGLSPGAVAG 84

  Fly    77 GTGGS----------GASAPWLHLSPYGHHGSGSLP--SVNRMA--------ALSTISLFPQT-- 119
            ..|.|          |.:|....|||.|....|:.|  |:|.:.        .:|.::..|..  
Mouse    85 MPGASAGAMNSMTAAGVTAMGTALSPGGMGSMGAQPATSMNGLGPYAAAMNPCMSPMAYAPSNLG 149

  Fly   120 ---------QRIFQPEEP--KPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGW 173
                     .:.|:...|  ||.:|||.||.|||..:....|.||:|||:|:|.:||:|.....|
Mouse   150 RSRAGGGGDAKTFKRSYPHAKPPYSYISLITMAIQQAPSKMLTLSEIYQWIMDLFPYYRQNQQRW 214

  Fly   174 RNSIRHNLSLNDCFIKSGRSAN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDA 236
            :|||||:||.||||:|..||.:  |||.||.:||.:...|..|.:.||:.:.|..|..|......
Mouse   215 QNSIRHSLSFNDCFVKVARSPDKPGKGSYWTLHPDSGNMFENGCYLRRQKRFKCEKQPGAGGGSG 279

  Fly   237 STDSPSPPP--LDLTTPPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQ 299
            ...|...|.  .|.:.|..||::|         |.|:...|:......||.      |.||...|
Mouse   280 GGGSKGGPESRKDPSGPGNPSAES---------PLHRGVHGKASQLEGAPA------PGPAASPQ 329

  Fly   300 RQEANNLDQTIQPTQLQQPHS 320
            ..:.:....|...::|:.|.|
Mouse   330 TLDHSGATATGGASELKSPAS 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/85 (52%)
Foxa1NP_032285.2 Forkhead_N 17..169 CDD:369872 29/148 (20%)
FH 170..258 CDD:214627 44/87 (51%)
Essential for DNA binding 251..288 8/36 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 269..396 22/97 (23%)
HNF_C 394..457 CDD:370449
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.