DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxd1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_032268.2 Gene:Foxd1 / 15229 MGIID:1347463 Length:456 Species:Mus musculus


Alignment Length:255 Identity:80/255 - (31%)
Similarity:100/255 - (39%) Gaps:88/255 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 GGTGGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEPKPQHSYIGLIAM 140
            ||..|.|..|        |..|....|.|                        ||.:|||.||.|
Mouse   109 GGGAGGGTGA--------GTGGGAKNPLV------------------------KPPYSYIALITM 141

  Fly   141 AILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWAI 203
            |||.|...:|.||:|.::|...:||:|.:.|.|:|||||||||||||:|..|...  |||:||.:
Mouse   142 AILQSPKKRLTLSEICEFISSRFPYYREKFPAWQNSIRHNLSLNDCFVKIPREPGNPGKGNYWTL 206

  Fly   204 HPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDS----------------------PSPPP- 245
            .|.:.:.|..|.|.||   ||..|...|....|:.::                      |.||| 
Mouse   207 DPESADMFDNGSFLRR---RKRFKRQPLLAPHAAAEALLLRGAGPAAGAGDPGAALFPPPPPPPA 268

  Fly   246 ---------LDLTTPP--PPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPDP 294
                     ..|..||  |||:..|...:|....:|.|                 |||.|
Mouse   269 CGYGAYGCAYGLQLPPCAPPSALFAAAAAAAAAAFHPH-----------------SPPPP 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/85 (52%)
Foxd1NP_032268.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..104
Forkhead 130..216 CDD:278670 44/85 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 303..322 6/26 (23%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 381..401
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.