DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxq1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_032265.3 Gene:Foxq1 / 15220 MGIID:1298228 Length:400 Species:Mus musculus


Alignment Length:194 Identity:69/194 - (35%)
Similarity:95/194 - (48%) Gaps:49/194 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PQYGGTGGSGASAPWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEPKPQHSYIGL 137
            |..||.||                |.|:...             |.|:|      |||.:|||.|
Mouse    94 PCAGGVGG----------------GEGARSK-------------PYTRR------PKPPYSYIAL 123

  Fly   138 IAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN---GKGH 199
            |||||..|...:|.|::|.:|::..:|:||....|||||:||||||||||:|..|..:   ||.:
Mouse   124 IAMAIRDSAGGRLTLAEINEYLMGKFPFFRGSYTGWRNSVRHNLSLNDCFVKVLRDPSRPWGKDN 188

  Fly   200 YWAIHPANMEDFRKGDFRRRK---AQRKVRKHMGLSVDDASTDSPSPPPLDLTTP-PPPSSQSA 259
            ||.::|.:...|..|.||||:   :.|......||..::|       ||....|| |.|:::|:
Mouse   189 YWMLNPNSEYTFADGVFRRRRKRLSHRTTVSASGLRPEEA-------PPGPAGTPQPAPAARSS 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 42/86 (49%)
Foxq1NP_032265.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..112 8/46 (17%)
FH 115..193 CDD:238016 40/77 (52%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 213..264 11/40 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.