DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxs1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_034356.1 Gene:Foxs1 / 14239 MGIID:95546 Length:329 Species:Mus musculus


Alignment Length:139 Identity:58/139 - (41%)
Similarity:78/139 - (56%) Gaps:12/139 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PQTQRIFQPEEP-KPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHN 180
            |..:.:....|| ||.:|||.||||||.||...:..||.||:||:..:.::|...|||:||||||
Mouse     5 PSPESLAPSAEPTKPPYSYIALIAMAIQSSPGQRATLSGIYRYIMGRFAFYRHNRPGWQNSIRHN 69

  Fly   181 LSLNDCFIKSGRSAN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMG-------LSVDDA 236
            ||||:||:|..|...  |||.||.:.|...:.|:.|.|.||:  |:..|..|       :.:|..
Mouse    70 LSLNECFVKVPRDDRKPGKGSYWTLDPDCHDMFQHGSFLRRR--RRFTKRTGAQGTKGPVKIDHR 132

  Fly   237 STDSPSPPP 245
            ...:.||.|
Mouse   133 PHRATSPDP 141

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 44/85 (52%)
Foxs1NP_034356.1 Forkhead 18..103 CDD:278670 43/84 (51%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 117..150 5/25 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 174..213
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.810

Return to query results.
Submit another query.