Sequence 1: | NP_651951.1 | Gene: | fd102C / 43843 | FlyBaseID: | FBgn0039937 | Length: | 599 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_032048.1 | Gene: | Foxd4 / 14237 | MGIID: | 1347467 | Length: | 444 | Species: | Mus musculus |
Alignment Length: | 240 | Identity: | 78/240 - (32%) |
---|---|---|---|
Similarity: | 103/240 - (42%) | Gaps: | 56/240 - (23%) |
- Green bases have known domain annotations that are detailed below.
Fly 117 PQTQRIFQPEEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNL 181
Fly 182 SLNDCFIKSGRSAN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPP 244
Fly 245 P--------------LDLTTPP----------PPSSQSALQLSALGYPYHQHYI-------GQFF 278
Fly 279 NRSSAPGMTHYSPPDPALLMQRQEANNLDQTIQPTQLQQPHSHHQ 323 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
fd102C | NP_651951.1 | Forkhead | 129..213 | CDD:278670 | 45/85 (53%) |
Foxd4 | NP_032048.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..70 | ||
Forkhead | 103..189 | CDD:278670 | 45/85 (53%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 234..256 | 5/21 (24%) | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG2294 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1270467at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0000010 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
4 | 3.820 |