DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and Foxd4

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_032048.1 Gene:Foxd4 / 14237 MGIID:1347467 Length:444 Species:Mus musculus


Alignment Length:240 Identity:78/240 - (32%)
Similarity:103/240 - (42%) Gaps:56/240 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   117 PQTQRIFQPEEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNL 181
            |.|.....|:..||.:|||.||.||||.|...:|.||.|..:|...:||:|.:.|.|:|||||||
Mouse    91 PATTTADGPQPAKPPYSYIALITMAILQSPHKRLTLSGICAFISGRFPYYRRKFPAWQNSIRHNL 155

  Fly   182 SLNDCFIKSGRSAN--GKGHYWAIHPANMEDFRKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPP 244
            ||||||:|..|...  |||:||::.||:.:.|..|.|.||:  ::.::|...|  ......|.||
Mouse   156 SLNDCFVKIPREPGHPGKGNYWSLDPASQDMFDNGSFLRRR--KRFKRHHPPS--GGHPHCPFPP 216

  Fly   245 P--------------LDLTTPP----------PPSSQSALQLSALGYPYHQHYI-------GQFF 278
            |              |..:.||          ||.|.....|    :|:...|:       |.  
Mouse   217 PAVPATLHVSQPSLLLRYSAPPQPNLAAHPAAPPRSHPCAPL----HPHPMRYLLLAAPAYGD-- 275

  Fly   279 NRSSAPGMTHYSPPDPALLMQRQEANNLDQTIQPTQLQQPHSHHQ 323
            |...|.|.   .|..|..:          ..:||....||....|
Mouse   276 NPRKAEGA---DPATPLAI----------PALQPVLGSQPWERDQ 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
Foxd4NP_032048.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..70
Forkhead 103..189 CDD:278670 45/85 (53%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 234..256 5/21 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.