DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and LOC101730723

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_031760018.1 Gene:LOC101730723 / 101730723 -ID:- Length:337 Species:Xenopus tropicalis


Alignment Length:293 Identity:67/293 - (22%)
Similarity:110/293 - (37%) Gaps:93/293 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   102 PSVNRM---AALSTISLFPQTQRIFQ-PEEP-------------------KPQHSYIGLIAMAIL 143
            ||:.:.   ||.:..:|.|..:...: |.||                   ||.:||:.:||:.|.
 Frog    18 PSMEKKSAPAAANRATLPPSPKGDSEGPREPDSSADWKKKKKKKSYQRYAKPPYSYLAMIALVIQ 82

  Fly   144 SSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCF---IKSGRSANGKGHYWAI-- 203
            :..:.:|.||.|.|.|...:|:|:....||::|||||||.||||   :|.......||:||.:  
 Frog    83 NCPEKRLKLSQILQDISSLFPFFKGNYQGWKDSIRHNLSSNDCFRKVLKDPLKPQAKGNYWTVDV 147

  Fly   204 --------------------HPANMEDF--RKGDFRRRKAQRKVRKHMGLSVDDASTDSPSPPPL 246
                                .|.::..:  ....:|.|.:....|:|             :.|.:
 Frog   148 TRIPPDALKLQNTAVTRQDLFPLDLAPYILHGQPYRERHSANHTREH-------------TTPRM 199

  Fly   247 DLTTPPPPSSQSALQLSALGYPYHQHYIGQFFNRSSAPGMTHYSPPD--PALLMQR--------- 300
            :|...|    |..:...|:.:|.....:...:.:..||.:.  :||.  |.||...         
 Frog   200 ELKVAP----QIPVSDPAVSFPMILWNLPTSYTKCVAPNVV--APPSVHPLLLYSNFPSISIYNY 258

  Fly   301 ---------QEANNLDQTI----QPTQLQQPHS 320
                     ..|::|...|    :|.:|:.|.|
 Frog   259 LPPPYGSPVYSASSLHPQIPLTPRPPELKNPPS 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 34/110 (31%)
LOC101730723XP_031760018.1 COG5025 66..>322 CDD:227358 58/245 (24%)
FH_FOXH 68..146 CDD:410796 33/77 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.