DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxl2

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_004917868.1 Gene:foxl2 / 100486124 XenbaseID:XB-GENE-486612 Length:326 Species:Xenopus tropicalis


Alignment Length:293 Identity:89/293 - (30%)
Similarity:123/293 - (41%) Gaps:79/293 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    95 HHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEPKPQHSYIGLIAMAILSSTDMKLVLSDIYQYI 159
            |:.:|     |:.|..|...|.|:..:.......||.:||:.||||||..|.:.:|.||.|||||
 Frog    41 HNSNG-----NKEAERSKEDLLPEKGQEKPDPSQKPPYSYVALIAMAIRESAEKRLTLSAIYQYI 100

  Fly   160 LDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSANG--KGHYWAIHPANMEDFRKGDFRRRKAQ 222
            :..:|::.....||:||||||||||:||||..|...|  ||:||.:.||..:.|.||::|||:..
 Frog   101 ISKFPFYEKNKKGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNYRRRRRM 165

  Fly   223 RK------VRKHMGLSVDDASTDSPSPPP-----------LDLTTPPPPSSQSALQL-------- 262
            ::      .....|.|:..:.|.....||           ..|..||.|.|.::.|:        
 Frog   166 KRPFRPPPTHFQAGKSLFSSDTYGYLSPPKYLQSTFMNNSWPLAQPPAPMSYTSCQMAGGNVSPV 230

  Fly   263 -------SALGYPY------------------------HQHYIGQFFNRSSAPGMTHYSPPDPAL 296
                   |:...||                        |.|:..|....|.||     :||.|  
 Frog   231 NVKGLSASSSYSPYSRVQSMSLPSMVNSYNGMSHHHHPHAHHAQQLSPASPAP-----APPAP-- 288

  Fly   297 LMQRQEANNLDQTI--QPTQLQQPH-SHHQHFA 326
                  .|.:..|.  ||:.|...| |:..|.|
 Frog   289 ------PNGVQFTCARQPSDLSMMHCSYWDHDA 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
foxl2XP_004917868.1 Forkhead 69..155 CDD:365978 44/85 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.