DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxl2b

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:NP_001304690.1 Gene:foxl2b / 100149117 ZFINID:ZDB-GENE-170803-1 Length:285 Species:Danio rerio


Alignment Length:260 Identity:90/260 - (34%)
Similarity:128/260 - (49%) Gaps:56/260 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   119 TQRIFQPEEP-------------KPQHSYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRG 170
            |..:.:.:||             ||.:||:.||||||..||:.:|.||.|||||:..:|::....
Zfish    19 TNAVKKEDEPLQEPGSEKTDPAQKPPYSYVALIAMAIRESTEKRLTLSGIYQYIITKFPFYEKNK 83

  Fly   171 PGWRNSIRHNLSLNDCFIKSGRSANG--KGHYWAIHPANMEDFRKGDFRRRKAQRK------VRK 227
            .||:||||||||||:||||..|...|  ||:||.:.||..:.|.||::|||:..::      ...
Zfish    84 KGWQNSIRHNLSLNECFIKVPREGGGERKGNYWTLDPACEDMFEKGNYRRRRRMKRPFRPPAAHF 148

  Fly   228 HMGLSV--DDASTD-SPSPPPLD---------LTTPPPPS-SQSALQ--------LSALGYPYHQ 271
            ..|.|:  .||.|. .|:|..|.         |..||||: |.::.|        :.||..|.:.
Zfish   149 QAGKSLFGGDAYTGYLPAPKYLQSGFMNSSWPLPQPPPPAMSYASCQMPNGNMGAMKALSTPSYN 213

  Fly   272 HY-----IGQFFNRSSAPGMTHYSPPDPALLMQRQEA--NNLDQTIQPTQLQQP---HSHHQHFA 326
            .|     :|.....:|..||.|:..|.    .|:|.|  :|....:|.|..:||   :|:.:|.|
Zfish   214 PYSRMQAMGLPNMMNSYGGMGHHQQPQ----HQQQSAAPSNSAAALQFTCSRQPAELYSYWEHEA 274

  Fly   327  326
            Zfish   275  274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 46/85 (54%)
foxl2bNP_001304690.1 FH 42..130 CDD:214627 47/87 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2294
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.