DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxl1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_012817795.1 Gene:foxl1 / 100038263 XenbaseID:XB-GENE-5880620 Length:406 Species:Xenopus tropicalis


Alignment Length:366 Identity:104/366 - (28%)
Similarity:142/366 - (38%) Gaps:97/366 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 PQYGGTGGSGASAPWLHLSP----YGHHGSGSLPSVNRMAALSTISLFPQTQRIFQPEEP-KPQH 132
            ||.|..         ||.||    ||.. ...:|::.          |..|..|.:.|.| ||.:
 Frog    10 PQLGSD---------LHRSPLVYLYGAE-RALVPALG----------FASTNVISRQEPPQKPPY 54

  Fly   133 SYIGLIAMAILSSTDMKLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN-- 195
            |||.||||||..|.|.::.|:.|||:|:|.:|::.....||:|||||||||||||||..|...  
 Frog    55 SYIALIAMAIKDSPDHRVTLNGIYQFIMDRFPFYHDNKQGWQNSIRHNLSLNDCFIKVPREKGRP 119

  Fly   196 GKGHYWAIHPANMEDFRKGDFRRRKAQRKV------RKHMGLSVD----DASTDSPSPPPLDLTT 250
            |||.||.:.|..::.|..|:|||||.:.|.      ::|...:.:    ||:....:......| 
 Frog   120 GKGSYWTLDPKCLDMFENGNFRRRKRKPKPILCQEGKRHKAEAAEYRLADAACKGTTCKVAGNT- 183

  Fly   251 PPPPSSQSALQLSALG----YPYHQHYIGQFFNRSSAPGMTHYSPPDPALLMQRQEA------NN 305
                 .|:..|.:.||    ....:...|:..:.....|...|....||.....||.      |:
 Frog   184 -----GQNGSQDAPLGRKPTSACEKDSAGEMSSSEDEGGSGDYIKTSPAPECHNQERTSGTYWNS 243

  Fly   306 L------------DQTIQPTQLQQPHSHHQHFAYI----------------NSTTTTTIAN---- 338
            |            ||....::.:...:|.|....:                |.....|.||    
 Frog   244 LHPSFYVSVPLLSDQVTLSSKREGSQAHEQGNRLLACGAQGHLGAPSPGSNNEKAGATDANCKEA 308

  Fly   339 -MFSQTRKRQFDVASLL-----------APDVQIVDIVSED 367
             ..||...|.|.:.|:|           ||....|..|.||
 Frog   309 EQLSQKSARSFSIDSILSRSDQSAPECGAPAPPAVSKVPED 349

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 45/85 (53%)
foxl1XP_012817795.1 Forkhead 50..136 CDD:365978 44/85 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R2114
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.