DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fd102C and foxe1

DIOPT Version :9

Sequence 1:NP_651951.1 Gene:fd102C / 43843 FlyBaseID:FBgn0039937 Length:599 Species:Drosophila melanogaster
Sequence 2:XP_002936729.1 Gene:foxe1 / 100038190 XenbaseID:XB-GENE-478544 Length:377 Species:Xenopus tropicalis


Alignment Length:292 Identity:92/292 - (31%)
Similarity:132/292 - (45%) Gaps:69/292 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    85 APWLHLSPYGHHGSGSLPSVNRMAALSTISLFPQTQRIFQP-EEPKPQHSYIGLIAMAILSSTDM 148
            ||...:|..|..|..:                |:.:|..:| ::.||.:|||.||||||.:|||.
 Frog    37 APEASMSNGGSEGEDT----------------PKGRRRKRPLQKGKPPYSYIALIAMAIANSTDR 85

  Fly   149 KLVLSDIYQYILDNYPYFRSRGPGWRNSIRHNLSLNDCFIKSGRSAN--GKGHYWAIHPANMED- 210
            ||.|..||::|.:.:|::|.....|:|||||||:|||||||..|...  |||:|||:.| |.|| 
 Frog    86 KLTLGGIYKFITERFPFYRDNSKKWQNSIRHNLTLNDCFIKIPREPGRPGKGNYWALDP-NAEDM 149

  Fly   211 FRKGDF-RRRKAQRKVRKHMGLSVDDASTDSPSPPPLDLTTPP----PPSSQSALQLSALGYP-- 268
            |..|.| ||||..::.                     ||||.|    ..|..|.||::...||  
 Frog   150 FDSGSFLRRRKRFKRT---------------------DLTTYPAYIHDTSMFSPLQVARATYPNT 193

  Fly   269 -YHQHYIGQFFNRSSAPGMTHYSP-PDPALLMQRQEANNLDQTI---------QPTQLQQPHSHH 322
             |....:...:::..||..:.|.| ..||....:....:::..|         ||.:...|.   
 Frog   194 VYPNMTMSPSYSQQIAPHSSVYYPSSSPAFSSAQPRVFSINTLIGHSGSEHAQQPNRSISPE--- 255

  Fly   323 QHFAYINSTTTTTIANMFSQTRKRQFDVASLL 354
                 :|||:::: .|....|...|....::|
 Frog   256 -----VNSTSSSS-CNYGGSTYSSQAGSGTML 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fd102CNP_651951.1 Forkhead 129..213 CDD:278670 49/86 (57%)
foxe1XP_002936729.1 FH 66..154 CDD:214627 49/88 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1270467at2759
OrthoFinder 1 1.000 - - FOG0000010
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.