DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyf and AT5G42950

DIOPT Version :10

Sequence 1:NP_001162827.1 Gene:Gyf / 43842 FlyBaseID:FBgn0039936 Length:1574 Species:Drosophila melanogaster
Sequence 2:NP_199109.1 Gene:AT5G42950 / 834307 AraportID:AT5G42950 Length:1714 Species:Arabidopsis thaliana


Alignment Length:36 Identity:11/36 - (30%)
Similarity:17/36 - (47%) Gaps:3/36 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   194 SSYRCLNGTDIYSEDLSVQI---ELFTTKRGCSRWV 226
            |:.|...|..|.|..|.:|.   |:|...:..|:|:
plant   188 SATRPWRGNLISSRLLPLQYQGWEMFNVTQTVSKWI 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GyfNP_001162827.1 GYF 569..613 CDD:460496
Mplasa_alph_rch <931..>1113 CDD:275316
AT5G42950NP_199109.1 GYF 546..603 CDD:238027
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.