DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyf and sao-1

DIOPT Version :9

Sequence 1:NP_001162827.1 Gene:Gyf / 43842 FlyBaseID:FBgn0039936 Length:1574 Species:Drosophila melanogaster
Sequence 2:NP_001360561.1 Gene:sao-1 / 3565237 WormBaseID:WBGene00011195 Length:247 Species:Caenorhabditis elegans


Alignment Length:301 Identity:62/301 - (20%)
Similarity:110/301 - (36%) Gaps:84/301 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   563 PNLNELWFYRDPQANVQGPFSAVEMTEWYRAGYFNENLFVRRYSDNRFRPLGELIKFCHGNMPFT 627
            |.::..|.|..|.:...||:.:.:|..|.:|||||:.|.::..::..:..|||..:.. |..|| 
 Worm     9 PVIDTKWHYLGPDSEKYGPYMSKDMLFWLQAGYFNDGLQLKTENEPNYHTLGEWSQLL-GTHPF- 71

  Fly   628 HSHLLPSPIELENIPVGQIPAPLTASLSITPHKPSPIPIALSVVEQQLQQQRDEQLKANVTATAE 692
                        ::||..:.|.:....|:.||.      |:.:|...||.|....          
 Worm    72 ------------SMPVHSLDATIAQMNSMRPHG------AMMMVPPGLQNQFQPP---------- 108

  Fly   693 ALRAAIKGSFGGNSIGNTSHLLTMRFQMLQDQYIQHQEYQ----ILAELSKNECFQRLSA----- 748
                                 :.|||.......:.||..|    :.|::......:.:.|     
 Worm   109 ---------------------MPMRFPPFLPMPLLHQMNQNGPPMGAQMHSQPPSEPIDAGSLSH 152

  Fly   749 ---VEQETVVRRKVQLLGLPEYLISLNGLSNSLSVLNPVAGRQ--LYRAVVEHAKKDQQHI---- 804
               .|.||.:..:. |...|.:||:| ||:..        ||:  .::.::.|     |||    
 Worm   153 TPDSENETRLNEQT-LQQPPSWLIAL-GLAGH--------GRKPHHHQQILAH-----QHIPQMQ 202

  Fly   805 FANTEQQRSVGNLLDANNFILNAQIMIQQSQQEVGPLVSSV 845
            .||....:.|...::.....:..||..:|:.:.:..|:..:
 Worm   203 HANVATDQVVMKSVECQTEPVEFQISKEQASRVLSELLGQM 243

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GyfNP_001162827.1 GYF 566..621 CDD:238027 16/54 (30%)
PKK 998..1112 CDD:289257
sao-1NP_001360561.1 GYF 13..68 CDD:214666 16/55 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001680
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.