DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Gyf and K11H3.8

DIOPT Version :10

Sequence 1:NP_001162827.1 Gene:Gyf / 43842 FlyBaseID:FBgn0039936 Length:1574 Species:Drosophila melanogaster
Sequence 2:NP_001255035.1 Gene:K11H3.8 / 13190936 WormBaseID:WBGene00185002 Length:274 Species:Caenorhabditis elegans


Alignment Length:73 Identity:26/73 - (35%)
Similarity:40/73 - (54%) Gaps:4/73 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   570 FYRDPQANVQGPFSAVEMTEWYRAGYFNENLFVRRYSDNRFRPLGELIKF--CHGNMPFTHSHLL 632
            ||.|.:..||||:.|..:.:||:.|||::| ...|::||..| :|.|..:  ..|.|...:....
 Worm    13 FYTDDRGTVQGPYGASTVLDWYQKGYFSDN-HQMRFTDNGQR-IGNLFTYETTLGEMKARYGEEA 75

  Fly   633 PSPIELEN 640
            |.|.:||:
 Worm    76 PIPTKLED 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GyfNP_001162827.1 GYF 569..613 CDD:460496 18/42 (43%)
Mplasa_alph_rch <931..>1113 CDD:275316
K11H3.8NP_001255035.1 GYF 9..65 CDD:238027 20/53 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.