DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-13 and AT5G44760

DIOPT Version :9

Sequence 1:NP_001245427.1 Gene:unc-13 / 43841 FlyBaseID:FBgn0025726 Length:3186 Species:Drosophila melanogaster
Sequence 2:NP_199289.1 Gene:AT5G44760 / 834505 AraportID:AT5G44760 Length:478 Species:Arabidopsis thaliana


Alignment Length:151 Identity:39/151 - (25%)
Similarity:61/151 - (40%) Gaps:40/151 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly  2162 IAITVICAQGLIAKDKSGTSDPYVTVQ--VSKVKKRTR-TMPQELNPVWNEKFHF----ECHNSS 2219
            :.:.||.||.|:....:.| :|.|.|:  |..|..|:| :..:.::||....:..    ||....
plant   193 LRVNVIEAQVLVLLQGNRT-NPEVLVKGFVGNVVVRSRVSQSRTMSPVLERGYDVGQKEECLGLC 256

  Fly  2220 DRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMD-VWYNLEKRTDKSAVSGAIR 2283
            :              .||.|              :|.|.|.|.:. :||||| |...|..:|  |
plant   257 E--------------IKLSQ--------------VERRVLPGPVPALWYNLE-RVGDSGFAG--R 290

  Fly  2284 LHISVEIKGEEKVAPYHVQYT 2304
            :|:.|.:.|...|....:||:
plant   291 IHLRVSLDGGYHVLDESIQYS 311

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-13NP_001245427.1 C1 2038..2087 CDD:237996
C2B_Munc13 2160..2286 CDD:175993 33/131 (25%)
DUF1041 2477..2584 CDD:283860
Membr_traf_MHD 2832..2992 CDD:287505
C2C_Munc13 3032..3152 CDD:176041
AT5G44760NP_199289.1 C2B_MCTP_PRT_plant 39..155 CDD:176024
C2 192..316 CDD:301316 39/151 (26%)
C2 328..450 CDD:301316
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D234298at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.