DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-13 and AT5G17980

DIOPT Version :9

Sequence 1:NP_001245427.1 Gene:unc-13 / 43841 FlyBaseID:FBgn0025726 Length:3186 Species:Drosophila melanogaster
Sequence 2:NP_197299.1 Gene:AT5G17980 / 831665 AraportID:AT5G17980 Length:1049 Species:Arabidopsis thaliana


Alignment Length:613 Identity:131/613 - (21%)
Similarity:218/613 - (35%) Gaps:197/613 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly  2161 KIAITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNS------S 2219
            |:.:.|:.|:.|..||..|||.|||.:.....::||||:.::|||||||...|.....      :
plant     6 KLVVEVVDAKDLTPKDGHGTSSPYVVLDYYGQRRRTRTIVRDLNPVWNETLEFSLAKRPSHQLFT 70

  Fly  2220 DRIKVRVWDEDNDLKSKLRQKLTR---ESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGA 2281
            |.:::.::.:.|..:::....|.|   .||.|:||        ..|..::|.|||::..:.|.|.
plant    71 DVLELDMYHDKNFGQTRRNNFLGRIRLGSDQFVGQ--------GEEALIYYPLEKKSLFNLVQGE 127

  Fly  2282 IRLHI-------------------SVEIKGEEKVA---------------PYHVQYTC------- 2305
            |.|.:                   .||.|.||..|               |..|:.|.       
plant   128 IGLRVYYADEKPPPLKPTVAPLETVVEEKTEETKAEGPDESKPPPETNDIPAEVKETVKPPQPPP 192

  Fly  2306 ------------------LHENLFHYLCEENTGMVKLPTQKGD--DAWKLYFDEIPEEIVDEFSM 2350
                              |.||       ...|..:.|..:.|  :|.....:|.|:...|    
plant   193 EESSPAEGPKPDEEASPPLQEN-------ATVGGEEPPASESDKNEAEAKPVEEPPQNQPD---- 246

  Fly  2351 RYGIENIYQAMTHFHCLSA-----------KYLCPGVPAVMS---TLLANINAYYAHTTASSAVS 2401
              |.:.:.::.......||           :.:...:|...:   .|..:::...::|:..|.||
plant   247 --GEDIVLESEDTMSWASAPRSPLPEVIISRSVSGSIPETKNGPQPLRRSVSETASYTSEISDVS 309

  Fly  2402 ASDRFAASNFGKEKFVKLLDQLHN-SLRIDLSMYRNNFPAS-SPEKLMDLKSTV-----DLLTSI 2459
            ..:|   |.|      .|::::|. .:|:   :...:.|.| ||...:.|..|:     ...||.
plant   310 TIER---STF------DLVEKMHYVFIRV---VKARSLPTSGSPVTKISLSGTMIQSKPARKTSC 362

  Fly  2460 -----TF-FRMKVQELSSPPRASTVVKDCVKACLRSTYQFLFENCYELYNREFQVDPNEAKRAPD 2518
                 || |.....:|||.|.....|.|.....  .|.|||...|:::.....: ||.::..||.
plant   363 FEWDQTFAFLRDSPDLSSSPILEISVWDSSTGI--ETSQFLGGICFDVSEIPLR-DPPDSPLAPQ 424

  Fly  2519 DHEPKLDSVDFWHKLIALIVSVIDEDKNSYGTVL-----------NQFPQEL---NIGQLSA--- 2566
                       |::|         |...::.:.|           ..||...   ..|.::|   
plant   425 -----------WYRL---------EGGGAHNSDLMLATWTGTQADESFPDAWKTDTAGNVTARAK 469

  Fly  2567 ----SSMWHLFAVDMKYALEEHEQHRLCKSSAYMNLHFRVKWLYSNYVKEVPPYKGAVP--DYPA 2625
                |.:|:|.|     .:.|.:.....:.:|:....|::|....:.|::.   |.||.  ..|:
plant   470 VYMSSKLWYLRA-----TVIEAQDLLPPQLTAFKEASFQLKAQLGSQVQKT---KSAVTRNGAPS 526

  Fly  2626 W--------FEPFVMQWLNENDDVSLEY 2645
            |        .|||..|.:     .:|||
plant   527 WNEDLLFVAAEPFSDQLV-----FTLEY 549

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-13NP_001245427.1 C1 2038..2087 CDD:237996
C2B_Munc13 2160..2286 CDD:175993 42/133 (32%)
DUF1041 2477..2584 CDD:283860 23/127 (18%)
Membr_traf_MHD 2832..2992 CDD:287505
C2C_Munc13 3032..3152 CDD:176041
AT5G17980NP_197299.1 C2A_MCTP_PRT_plant 6..136 CDD:175989 42/137 (31%)
C2B_MCTP_PRT_plant 324..446 CDD:176024 31/147 (21%)
C2C_MCTP_PRT_plant 478..623 CDD:175986 19/85 (22%)
C2D_MCTP_PRT_plant 635..764 CDD:176025
PRT_C 893..1049 CDD:285560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D234298at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.