DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-13 and AT5G12970

DIOPT Version :9

Sequence 1:NP_001245427.1 Gene:unc-13 / 43841 FlyBaseID:FBgn0025726 Length:3186 Species:Drosophila melanogaster
Sequence 2:NP_196801.1 Gene:AT5G12970 / 831137 AraportID:AT5G12970 Length:769 Species:Arabidopsis thaliana


Alignment Length:246 Identity:62/246 - (25%)
Similarity:101/246 - (41%) Gaps:56/246 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly  2114 RMKQREREKPEIFELIRAVF----SVEEKSHAGHMKA----------VKQSVLDGTSKWSAKIAI 2164
            |::.|...|.: .||:.||:    :.|..|.|.|..|          ::..|......|  .:.:
plant   144 RLEDRHGRKVK-GELMLAVWMGTQADEAFSDAWHSDAATVGPEGVTHIRSKVYLSPKLW--YVRV 205

  Fly  2165 TVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTR-TMPQELNPVWNEKFHFECHNSSDRIKVRVWD 2228
            .||.||.||..||:...:.||...:.....||| :..:.|||:|||...|        :....::
plant   206 NVIEAQDLIPHDKTKFPEVYVKAMLGNQTLRTRISQTKTLNPMWNEDLMF--------VVAEPFE 262

  Fly  2229 EDNDLKSKLRQKLTRESDDFLGQTIIEVRTLSGEMD------VWYNLEKRT----DKSAVSGAIR 2283
            |  .|...:..::....|:.||:..|.::.:...:|      .|:||||..    ::..:..|.|
plant   263 E--ALILAVEDRVAPNKDETLGRCAIPLQNVQRRLDHRPLNSRWFNLEKHIMVEGEQKEIKFASR 325

  Fly  2284 LHISVEIKGEEKVAPYHVQYTCLHENLFHYLCEENTGMVKLPTQKGDDAWK 2334
            :|:.:.::|     .|||    |.|:. ||..:..      ||.|  ..||
plant   326 IHLRIFLEG-----GYHV----LDEST-HYSSDLR------PTAK--QLWK 358

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-13NP_001245427.1 C1 2038..2087 CDD:237996
C2B_Munc13 2160..2286 CDD:175993 34/136 (25%)
DUF1041 2477..2584 CDD:283860
Membr_traf_MHD 2832..2992 CDD:287505
C2C_Munc13 3032..3152 CDD:176041
AT5G12970NP_196801.1 C2B_MCTP_PRT_plant 41..165 CDD:176024 7/21 (33%)
C2C_MCTP_PRT_plant 202..351 CDD:175986 43/174 (25%)
C2D_MCTP_PRT_plant 363..486 CDD:176025
PRT_C 614..769 CDD:285560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D234298at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.