DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-13 and AT3G61720

DIOPT Version :9

Sequence 1:NP_001245427.1 Gene:unc-13 / 43841 FlyBaseID:FBgn0025726 Length:3186 Species:Drosophila melanogaster
Sequence 2:NP_191731.1 Gene:AT3G61720 / 825345 AraportID:AT3G61720 Length:795 Species:Arabidopsis thaliana


Alignment Length:167 Identity:38/167 - (22%)
Similarity:72/167 - (43%) Gaps:22/167 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly  2162 IAITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSD-RIKVR 2225
            :.:|::....||:|||:.|...|||..:.||..:|: :....||.||:...|......: .:.:|
plant   201 VRVTIVSGHDLISKDKNKTPSVYVTATLGKVALKTK-VSSGTNPSWNQDLIFVASEPLEGTVYIR 264

  Fly  2226 VWDEDNDLK----SKLRQKLTRESDDFLGQTIIEVRTLSGEMDVWYNLEKRTDKSAVSGAIRLHI 2286
            :.|.:::..    ..|::|||.         :..::..|....::|::|..|:......:.|...
plant   265 LIDREDEQHEGCIGTLKKKLTE---------MTPLKVPSSAPALFYDIEMPTEVKPAGDSRRFAS 320

  Fly  2287 SVEIKGEEKVAPYHVQYTCLHENLFHYLCEENTGMVK 2323
            .:::|.....| |||...|...:      .:|...||
plant   321 RLKMKLATDQA-YHVAEECTQYS------SDNRAFVK 350

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-13NP_001245427.1 C1 2038..2087 CDD:237996
C2B_Munc13 2160..2286 CDD:175993 29/128 (23%)
DUF1041 2477..2584 CDD:283860
Membr_traf_MHD 2832..2992 CDD:287505
C2C_Munc13 3032..3152 CDD:176041
AT3G61720NP_191731.1 C2 42..163 CDD:387358
C2C_MCTP_PRT_plant 200..347 CDD:175986 36/162 (22%)
C2D_MCTP_PRT_plant 359..482 CDD:176025
PRT_C 632..795 CDD:337028
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D234298at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.