DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-13 and AT3G57880

DIOPT Version :9

Sequence 1:NP_001245427.1 Gene:unc-13 / 43841 FlyBaseID:FBgn0025726 Length:3186 Species:Drosophila melanogaster
Sequence 2:NP_001327704.1 Gene:AT3G57880 / 824957 AraportID:AT3G57880 Length:773 Species:Arabidopsis thaliana


Alignment Length:484 Identity:108/484 - (22%)
Similarity:177/484 - (36%) Gaps:119/484 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly  2078 KCKDLLNADCLQRAAEKSSKHGAEDKANSIITAMKDRMKQREREKPEIFELIRAVF----SVEEK 2138
            |.||.:..|.:.|.....::.......:|.:.....|::.|:.:|.: .||:.||:    :.|..
plant   107 KDKDFVKDDLIGRVVFDLNEVPKRVPPDSPLAPQWYRLEDRKGDKVK-GELMLAVWFGTQADEAF 170

  Fly  2139 SHAGHMKAVKQSVLDGTSKWSAKI---------AITVICAQGLIAKDKSGTSDPYVTVQVSKVKK 2194
            ..|.|..|...|..|..:...:|:         .:.||.||.||..||....:.||...|.....
plant   171 PEAWHSDAATVSGTDALANIRSKVYLSPKLWYLRVNVIEAQDLIPTDKQRYPEVYVKAIVGNQAL 235

  Fly  2195 RTR-TMPQELNPVWNEKFHFECHNSSDRIKVRVWDEDNDLKSKLRQKLTRESDDFLGQTIIEVRT 2258
            ||| :..:.:||:|||...|        :....::|  .|...:..::....|:.||:..|.::.
plant   236 RTRVSQSRTINPMWNEDLMF--------VAAEPFEE--PLILSVEDRVAPNKDEVLGRCAIPLQY 290

  Fly  2259 LSGEMD------VWYNLEKRT----DKSAVSGAIRLHISVEIKGEEKVAPYHVQYTCLHENLFHY 2313
            |....|      .||||||..    :|.....|.|:|:.:.::|     .|||    |.|:. ||
plant   291 LDRRFDHKPVNSRWYNLEKHIMVDGEKKETKFASRIHMRICLEG-----GYHV----LDEST-HY 345

  Fly  2314 ----------LCEEN-----------TGMVKLPTQKG---DDAWKL--YFDE--IPEEIVDEFSM 2350
                      |.:.|           ||::.:.|:.|   .||:.:  |..:  ....|:|.|:.
plant   346 SSDLRPTAKQLWKPNIGVLELGILNATGLMPMKTKDGRGTTDAYCVAKYGQKWIRTRTIIDSFTP 410

  Fly  2351 RYGIENIYQAM-------------THFH----CLSAKYLCPG-VPAVMSTLLANINAYYAHTTAS 2397
            |:..:..::..             .|.|    ...||....| |...:|||  ..:..|.|:...
plant   411 RWNEQYTWEVFDPCTVVTVGVFDNCHLHGGEKIGGAKDSRIGKVRIRLSTL--ETDRVYTHSYPL 473

  Fly  2398 SAVSASDRFAASNFGKEKFVKLLDQLHNSLRIDLS-----MYRNNFPA------SSPEKLMDLKS 2451
            ..:..:.            ||.:.::|.::|...|     ||..:.|.      ..|..:..|.:
plant   474 LVLHPNG------------VKKMGEIHLAVRFTCSSLLNMMYMYSQPLLPKMHYIHPLTVSQLDN 526

  Fly  2452 TVDLLTSITFFRMKVQELSSPPRASTVVK 2480
            .....|.|...|:...|   ||....||:
plant   527 LRHQATQIVSMRLTRAE---PPLRKEVVE 552

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-13NP_001245427.1 C1 2038..2087 CDD:237996 3/8 (38%)
C2B_Munc13 2160..2286 CDD:175993 38/145 (26%)
DUF1041 2477..2584 CDD:283860 2/4 (50%)
Membr_traf_MHD 2832..2992 CDD:287505
C2C_Munc13 3032..3152 CDD:176041
AT3G57880NP_001327704.1 C2B_MCTP_PRT_plant 40..164 CDD:176024 13/57 (23%)
C2C_MCTP_PRT_plant 202..351 CDD:175986 46/168 (27%)
C2D_MCTP_PRT_plant 363..490 CDD:176025 25/140 (18%)
PRT_C 618..773 CDD:337028
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D234298at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.