DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment unc-13 and AT3G03680

DIOPT Version :9

Sequence 1:NP_001245427.1 Gene:unc-13 / 43841 FlyBaseID:FBgn0025726 Length:3186 Species:Drosophila melanogaster
Sequence 2:NP_187018.1 Gene:AT3G03680 / 821190 AraportID:AT3G03680 Length:1017 Species:Arabidopsis thaliana


Alignment Length:194 Identity:51/194 - (26%)
Similarity:78/194 - (40%) Gaps:50/194 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  2161 KIAITVICAQGLIAKDKSGTSDPYVTVQVSKVKKRTRTMPQELNPVWNEKFHFECHNSSDRIKVR 2225
            |:.:.:..|:.|:.||..||:..|..|.....::||:|..::|||.|:||..|..|:      |.
plant     8 KLIVEICSARNLMPKDGQGTASAYAIVDFDGQRRRTKTKFRDLNPQWDEKLEFFVHD------VA 66

  Fly  2226 VWDED-------NDLKSKLRQKLTRESDDFLGQTII---EVRTLSGEMDVWYNLEKRTDKSAVSG 2280
            ...|:       ||       |.|.:...|||:..|   ...:...|..|:|.||||:       
plant    67 TMGEEILEINLCND-------KKTGKRSTFLGKVKIAGSAFASAGSETLVYYPLEKRS------- 117

  Fly  2281 AIRLHISVEIKGEEKVAPYHVQYTCLHENLFHYLCEENTGMVKLPTQKGDDAWKLYFDEIPEEI 2344
                 :..:||||..:..|:|              :||.......|:...:| ....:|.|.||
plant   118 -----VFSQIKGEIGLKAYYV--------------DENPPAAPAATEPKPEA-AAATEEKPPEI 161

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
unc-13NP_001245427.1 C1 2038..2087 CDD:237996
C2B_Munc13 2160..2286 CDD:175993 37/134 (28%)
DUF1041 2477..2584 CDD:283860
Membr_traf_MHD 2832..2992 CDD:287505
C2C_Munc13 3032..3152 CDD:176041
AT3G03680NP_187018.1 C2 8..134 CDD:301316 43/164 (26%)
C2B_MCTP_PRT_plant 282..407 CDD:176024
C2C_MCTP_PRT_plant 440..593 CDD:175986
C2D_MCTP_PRT_plant 605..733 CDD:176025
PRT_C 861..1017 CDD:285560
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D234298at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.