DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment eIF4G1 and AT4G30680

DIOPT Version :9

Sequence 1:NP_001096852.1 Gene:eIF4G1 / 43839 FlyBaseID:FBgn0023213 Length:1919 Species:Drosophila melanogaster
Sequence 2:NP_194797.1 Gene:AT4G30680 / 829191 AraportID:AT4G30680 Length:263 Species:Arabidopsis thaliana


Alignment Length:287 Identity:65/287 - (22%)
Similarity:107/287 - (37%) Gaps:73/287 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   529 QESVGLNNLTSTSSQGSESRTNAPYIPIETTPISRTDVGPTPIVSA------MTDAPSVEI---- 583
            |:...:.:|.....:|. ||..||...:.::. ..|:.|..|..:.      :.|.||..:    
plant     2 QQGDSMLSLRPGGGRGG-SRRFAPRFTLSSSS-DLTNGGDAPSFAVKGSGGLLNDRPSALVQGNG 64

  Fly   584 ------LPTPQRGRSKKIPIVSPKNVSESIVAPITDETDDAGSTPISRAT--------------- 627
                  :|:|.|...:| |...|:   ...|||.|  |....:..:||.|               
plant    65 SQQPKPVPSPTRQTVEK-PKPQPQ---PQEVAPPT--TTSLNTVELSRKTNSLLEEYFNVRLLDE 123

  Fly   628 -----EESMPPNQTHPNLLISDSSKHKQAVSNSEISKDAPTGLKEMHVAELESSVASENHPAGIL 687
                 ||...|:. ||.|:       |:|:|.. :.|:.|.   ...||:|...:.|:|      
plant   124 ALQCIEELKTPSY-HPELV-------KEAISLG-LEKNPPC---VEPVAKLLEHLVSKN------ 170

  Fly   688 DVNVNKSSQSLDFSADPEIDSIGAISPTSPNAVSPILHEVL----DNTELSKK-LENSTTERFKD 747
             |...|..::........:|.||...|.:||....||..::    .::||.|: |.....|.||.
plant   171 -VLTPKDLRNGCLLYGSMLDDIGIDLPKAPNNFGEILGSLVMAKASDSELVKEILMKMGDEWFKK 234

  Fly   748 S--QSVEKPTHQELSLRNATDETEISA 772
            :  ::|.:...:.|.   .|:..|:.|
plant   235 AVLEAVMRSVSESLL---TTEAVEVEA 258

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
eIF4G1NP_001096852.1 MIF4G 1004..1252 CDD:280935
MA3 1562..1677 CDD:280933
W2_eIF4G1_like 1764..1895 CDD:211397
AT4G30680NP_194797.1 MA3 104..214 CDD:280933 29/128 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0401
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D594395at2759
OrthoFinder 1 1.000 - - FOG0001079
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.910

Return to query results.
Submit another query.